| Clone Name | bastl18g01 |
|---|---|
| Clone Library Name | barley_pub |
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 53.9 bits (128), Expect = 2e-07 Identities = 31/53 (58%), Positives = 32/53 (60%), Gaps = 5/53 (9%) Frame = +3 Query: 282 MLPRKREIVASEVENQQKKARPXXXXXX-----XXXXGRPTEIDEDLHSRQLA 425 MLPRKREIVA EVE+ QKK R GR EIDEDLHSRQLA Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGEATREEGDAAMAGRGNEIDEDLHSRQLA 53
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 53.5 bits (127), Expect = 2e-07 Identities = 31/53 (58%), Positives = 32/53 (60%), Gaps = 5/53 (9%) Frame = +3 Query: 282 MLPRKREIVASEVENQQKKARP-----XXXXXXXXXXGRPTEIDEDLHSRQLA 425 MLPRKREIVA EVE+ QKK R GR EIDEDLHSRQLA Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGEVTREEGDAAMAGRGNEIDEDLHSRQLA 53
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 30.4 bits (67), Expect = 1.8 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +3 Query: 282 MLPRKREIVASEVENQQK--------KARPXXXXXXXXXXGRPTEIDEDLHSRQLA 425 MLP KR A+ + + R P EIDEDLHSRQLA Sbjct: 1 MLPSKRPSDAAAGDENGRGGDARGPGSGRRRARAAAGAVTAAPQEIDEDLHSRQLA 56
>BRD8_HUMAN (Q9H0E9) Bromodomain-containing protein 8 (p120) (Skeletal muscle| abundant protein) (Thyroid hormone receptor coactivating protein 120kDa) (TrCP120) Length = 1235 Score = 29.6 bits (65), Expect = 3.1 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 108 SLRFSSPLALPVSRRAAHGQLQVPPRTLDL 197 S RFSSP PVS R A G V R +DL Sbjct: 1121 SHRFSSPFLKPVSERQAPGYKDVVKRPMDL 1150
>RBL2_RAT (O55081) Retinoblastoma-like protein 2 (130 kDa| retinoblastoma-associated protein) (PRB2) (P130) (RBR-2) (PPAR-alpha-interacting complex protein 128) (PRIC128) Length = 1135 Score = 28.5 bits (62), Expect = 6.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 51 GSPRTPRILGELRTSAQSPSLRFSSPLAL 137 GSP TPR +GE+RT A +SP L Sbjct: 635 GSPLTPRRVGEVRTDAGGLGRSVTSPTTL 663
>PCSK6_HUMAN (P29122) Proprotein convertase subtilisin/kexin type 6 precursor| (EC 3.4.21.-) (Paired basic amino acid cleaving enzyme 4) (Subtilisin/kexin-like protease PACE4) (Subtilisin-like proprotein convertase 4) (SPC4) Length = 969 Score = 28.5 bits (62), Expect = 6.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 420 AGGCGGPRRSPWASLPWPW 364 AGG GGP P A PW W Sbjct: 33 AGGAGGPGFRPLAPRPWRW 51
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.1 bits (61), Expect = 9.0 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = +3 Query: 42 NPRGSPRTPRILGELRTSAQSPSLRFSSPLALPVSRRAAHGQLQVPPR 185 +PR TPR R S +SPS R SP A V R ++ PPR Sbjct: 80 HPRSRSPTPRSQSPSRRSVRSPSPRQGSP-ARRVDRSSSPRARSPPPR 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,901,464 Number of Sequences: 219361 Number of extensions: 457462 Number of successful extensions: 2083 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2081 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)