| Clone Name | bastl18a04 |
|---|---|
| Clone Library Name | barley_pub |
>COPB_DROME (P45437) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 964 Score = 41.2 bits (95), Expect = 7e-04 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +1 Query: 73 PCTLLVHFDKGSAAMANEIKADLEGSDVAAKVEAMKRAVMLLLNGETLPTLFI 231 PC +++ ++K DLE D K+E +KR + LLLNGE P L + Sbjct: 6 PCYTIINSPDLEVTNEMQLKRDLEKGDTNVKIETLKRVIKLLLNGERYPGLIM 58
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 41.2 bits (95), Expect = 7e-04 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 61 AMDKPCTLLVHFDKGSAAMAN-EIKADLEGSDVAAKVEAMKRAVMLLLNGETLPTLFI 231 A + C L++ S + +K DLE DV +K EA+K+ ++++LNGE LP L + Sbjct: 3 AAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM 60
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 41.2 bits (95), Expect = 7e-04 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 61 AMDKPCTLLVHFDKGSAAMAN-EIKADLEGSDVAAKVEAMKRAVMLLLNGETLPTLFI 231 A + C L++ S + +K DLE DV +K EA+K+ ++++LNGE LP L + Sbjct: 3 AAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM 60
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 41.2 bits (95), Expect = 7e-04 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 61 AMDKPCTLLVHFDKGSAAMAN-EIKADLEGSDVAAKVEAMKRAVMLLLNGETLPTLFI 231 A + C L++ S + +K DLE DV +K EA+K+ ++++LNGE LP L + Sbjct: 3 AAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM 60
>COPB_SCHPO (Q9UUF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 940 Score = 34.7 bits (78), Expect = 0.068 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +1 Query: 76 CTLLVHFDKGSAAMANEIKADLEGSDVAAKVEAMKRAVMLLLNGETLPTLFI 231 C LV D A + +K LE + K+ AMK + +++NG++LP++ + Sbjct: 3 CWTLVQQDFLEAPSVDALKTSLESKNDYVKISAMKTILRVVINGDSLPSILM 54
>NU2C_PROMM (Q7V626) NAD(P)H-quinone oxidoreductase chain 2 (EC 1.6.5.-)| (NAD(P)H dehydrogenase I, chain 2) (NDH-1, chain 2) Length = 523 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 164 LAATSLPSRSALISFAMAAEPLSKWTSSVHGLSMAP 57 LAA SL A ++F +AA P +WT V+ S P Sbjct: 222 LAALSLVFVLATVAFKIAAVPFHQWTPDVYEGSPTP 257
>VGLL_HCMV6 (Q68672) Glycoprotein L precursor| Length = 278 Score = 27.7 bits (60), Expect = 8.3 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +1 Query: 10 RYPTRRRPLARVHGRSGAMDKPCTLLVHFDKGSAAMANEIKADLEGSDVAAKV---EAMK 180 +Y + RPL V GR+G P + L+ + + AN + D D A + Sbjct: 64 KYESWLRPLVNVTGRNG----PLSQLIRYRPVTPEAANSVLLDDAFLDTLALLYNNPDQL 119 Query: 181 RAVMLLLNGETLP 219 RA++ LL+ +T P Sbjct: 120 RALLTLLSSDTAP 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,133,959 Number of Sequences: 219361 Number of extensions: 378987 Number of successful extensions: 1349 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1349 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)