| Clone Name | bastl17h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LAMB2_RAT (P15800) Laminin beta-2 chain precursor (S-laminin) (L... | 31 | 0.85 | 2 | LAMB2_MOUSE (Q61292) Laminin beta-2 chain precursor (S-laminin) ... | 30 | 1.1 | 3 | EHMT2_HUMAN (Q96KQ7) Histone-lysine N-methyltransferase, H3 lysi... | 30 | 1.9 | 4 | EHMT2_MOUSE (Q9Z148) Histone-lysine N-methyltransferase, H3 lysi... | 29 | 3.2 |
|---|
>LAMB2_RAT (P15800) Laminin beta-2 chain precursor (S-laminin) (Laminin chain| B3) Length = 1801 Score = 30.8 bits (68), Expect = 0.85 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 154 SSRPEKGRRGWPWPWPLDLGTRVPDLPTTTAR 59 S +P +GR+G P PW L LG + L T A+ Sbjct: 5 SGKPGRGRQGQPVPWELRLGLLLSVLAATLAQ 36
>LAMB2_MOUSE (Q61292) Laminin beta-2 chain precursor (S-laminin) (S-LAM)| Length = 1799 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 154 SSRPEKGRRGWPWPWPLDLGTRVPDLPTTTAR 59 S P +GR+G P PW L LG + L T A+ Sbjct: 5 SGEPGRGRQGQPLPWELRLGLLLSVLAATLAQ 36
>EHMT2_HUMAN (Q96KQ7) Histone-lysine N-methyltransferase, H3 lysine-9 specific 3| (EC 2.1.1.43) (Histone H3-K9 methyltransferase 3) (H3-K9-HMTase 3) (Euchromatic histone-lysine N-methyltransferase 2) (HLA-B-associated transcript 8) (Protein G9a) Length = 1210 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 69 VVGRSGTRVPKSSGHGHGQPRRP 137 V GR+ T P + GHG+PRRP Sbjct: 572 VPGRADTSQPSARMRGHGEPRRP 594
>EHMT2_MOUSE (Q9Z148) Histone-lysine N-methyltransferase, H3 lysine-9 specific 3| (EC 2.1.1.43) (Histone H3-K9 methyltransferase 3) (H3-K9-HMTase 3) (Euchromatic histone-lysine N-methyltransferase 2) (HLA-B-associated transcript 8) (Protein G9a) Length = 1263 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 75 GRSGTRVPKSSGHGHGQPRRP 137 GR+ T P + GHG+PRRP Sbjct: 627 GRADTSQPSARMRGHGEPRRP 647 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.299 0.119 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,033,441 Number of Sequences: 219361 Number of extensions: 220424 Number of successful extensions: 530 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 17 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.6 bits)