| Clone Name | bastl17e02 |
|---|---|
| Clone Library Name | barley_pub |
>GLSA_RHILO (Q98NB7) Glutaminase (EC 3.5.1.2)| Length = 315 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -3 Query: 81 SRDF-FRIGIPGLRSIGWAEIGVVPCV 4 S DF FR+GIPG +G +G+VP V Sbjct: 252 SGDFAFRVGIPGKSGVGGGILGIVPGV 278
>YCDA_DROME (Q9VGW1) Putative cadherin CG4509 precursor| Length = 1483 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 28 RPTYRSKPRDSNPEEIPRENRSKPRSSSLRIPQRRSGA 141 RP +S P DS PE +PR +R R SS R ++++ + Sbjct: 1143 RPARKSSPTDSQPEAMPRLSR---RDSSKRGSRKQTSS 1177
>NHR6_CAEEL (P41829) Nuclear hormone receptor family member nhr-6 (Cnr8)| Length = 619 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 46 KPRDSNPEEIPRENRSKPRSSSLRIPQRRSGA 141 KP + E IP E KP SSS R+P + + Sbjct: 109 KPTKTEVESIPEEFEQKPSSSSHRLPSEMNAS 140
>CNA_STAAU (Q53654) Collagen adhesin precursor| Length = 1183 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +1 Query: 13 HHTDFRPTYRSKPRDSNPEEIPRENRSKPRSSSLRIPQ 126 H +PT KP + ++ P++N++KP + +P+ Sbjct: 1116 HSNKVKPTPPDKPSKVDKDDQPKDNKTKPENPLKELPK 1153
>ZN265_RAT (O35986) Zinc finger protein 265 (Zinc finger, splicing)| Length = 332 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 43 SKPRDSNPEEIPRENRSKPRSSSLRIPQRRSGATS 147 S+ DSN ++ R +RSK RSS R R S +S Sbjct: 188 SEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSS 222
>GSHRP_ARATH (P42770) Glutathione reductase, chloroplast precursor (EC 1.8.1.7)| (GR) (GRase) Length = 565 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 213 RRIEFHPARRPHAAVAVGGGGFQMET 290 R IEFH P A + G G F ++T Sbjct: 314 RGIEFHTEESPEAIIKAGDGSFSLKT 339
>ZN265_HUMAN (O95218) Zinc finger protein 265 (Zinc finger, splicing)| Length = 337 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 43 SKPRDSNPEEIPRENRSKPRSSSLRIPQRRSGATS 147 S+ DSN ++ R +RSK RSS R R S +S Sbjct: 188 SEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSS 222
>ZN265_MOUSE (Q9R020) Zinc finger protein 265 (Zinc finger, splicing) (Fragment)| Length = 326 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 43 SKPRDSNPEEIPRENRSKPRSSSLRIPQRRSGATS 147 S+ DSN ++ R +RSK RSS R R S +S Sbjct: 188 SEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSS 222 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,157,739 Number of Sequences: 219361 Number of extensions: 696966 Number of successful extensions: 2690 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2689 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)