| Clone Name | bastl17d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MNN1_YEAST (P39106) Alpha-1,3-mannosyltransferase MNN1 (EC 2.4.1.-) | 30 | 1.8 | 2 | Y1218_METJA (Q58615) Hypothetical protein MJ1218 | 28 | 5.3 | 3 | LEC1_CYTSE (P22970) Anti-H(O) lectin I (CSA-I) | 27 | 9.1 | 4 | ONCA_TAETA (P22080) Oncosphere antigen A (Fragment) | 27 | 9.1 |
|---|
>MNN1_YEAST (P39106) Alpha-1,3-mannosyltransferase MNN1 (EC 2.4.1.-)| Length = 762 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -2 Query: 384 DESSF*KTTCMLMNSLNSIFPDVDPERTEGATVFVFPELRSPFSQKRTTE 235 D+ S + L+ +LN+ FP+ DP+ + F F PF TTE Sbjct: 209 DKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTE 258
>Y1218_METJA (Q58615) Hypothetical protein MJ1218| Length = 425 Score = 28.1 bits (61), Expect = 5.3 Identities = 23/88 (26%), Positives = 34/88 (38%), Gaps = 5/88 (5%) Frame = +2 Query: 131 LRTKTKKDAAIHVDFNIFIQEVSPWPPSESLKSLRSVVLFWENGERNSGKTNTVAPSVRS 310 L+++TK HVD IF P PP E K + ++ ++N K V + Sbjct: 135 LKSQTKGTGIPHVDKKIFENIKIPLPPLEEQKQIAKILSDFDNLIGTINKQIEVLNKAKK 194 Query: 311 GS-----TSGKIEFNEFISIQVVFQKED 379 G T G E F ++ ED Sbjct: 195 GMMKKLFTKGVFEHKSFKKSEIGEIPED 222
>LEC1_CYTSE (P22970) Anti-H(O) lectin I (CSA-I)| Length = 244 Score = 27.3 bits (59), Expect = 9.1 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 17/71 (23%) Frame = +2 Query: 161 IHVDFNIFIQEV-SPWPPS--------ESLKSLRSVVLFWENGE--------RNSGKTNT 289 I V+F+ + + +PW P S+KS+++V W NGE R K+ T Sbjct: 124 IAVEFDTYFGKTYNPWDPDFKHIGVDVNSIKSIKTVKWDWRNGEVANVVITYRAPTKSLT 183 Query: 290 VAPSVRSGSTS 322 V+ S S TS Sbjct: 184 VSLSYPSDQTS 194
>ONCA_TAETA (P22080) Oncosphere antigen A (Fragment)| Length = 318 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 335 IRSSLMWILSGLKVQRCLSSLNCVHHFPKKEP 240 + S ++ +GL+ Q LS+ CVH+ P+K P Sbjct: 258 LASVQLYTFTGLEPQVSLSASICVHYKPQKSP 289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,673,540 Number of Sequences: 219361 Number of extensions: 1091596 Number of successful extensions: 2420 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2420 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)