| Clone Name | bastl17c09 |
|---|---|
| Clone Library Name | barley_pub |
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 35.4 bits (80), Expect = 0.038 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 7/34 (20%) Frame = +2 Query: 14 PPRRDRSPVLPPR-------PHSRAPDPRTLTPP 94 PPRR RSP PPR P R+P PR +PP Sbjct: 585 PPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPP 618 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 Query: 5 LARPPRRDRSPVLPPRPHSRAPDPRTLTPPHAIPLAR 115 + + RR RSP PP R+P P PP P R Sbjct: 552 VTKSSRRRRSPSPPPARRRRSPSPAPPPPPPPPPPRR 588
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 35.0 bits (79), Expect = 0.050 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 6/33 (18%) Frame = +2 Query: 14 PPRRDRSPVLP------PRPHSRAPDPRTLTPP 94 PPRR RSP LP P P R+P PR +PP Sbjct: 560 PPRRRRSPSLPRRRSPSPPPRRRSPSPRRYSPP 592
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 35.0 bits (79), Expect = 0.050 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 7/36 (19%) Frame = +2 Query: 8 ARPPRRDRSPVLPPR-------PHSRAPDPRTLTPP 94 A PPRR R+P PPR P R+P PR +PP Sbjct: 578 APPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPP 613
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 35.0 bits (79), Expect = 0.050 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 7/36 (19%) Frame = +2 Query: 8 ARPPRRDRSPVLPPR-------PHSRAPDPRTLTPP 94 A PPRR R+P PPR P R+P PR +PP Sbjct: 564 APPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPP 599
>ROBO1_MOUSE (O89026) Roundabout homolog 1 precursor| Length = 1612 Score = 31.2 bits (69), Expect = 0.73 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 5 LARPPRRDRSPVLPPRPHSRAPDPRTLTPPH 97 + PP R R PV PP P PR ++PPH Sbjct: 1246 MPHPPDRRRQPVSPP------PPPRPISPPH 1270
>ROBO1_RAT (O55005) Roundabout homolog 1 precursor| Length = 1651 Score = 31.2 bits (69), Expect = 0.73 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 5 LARPPRRDRSPVLPPRPHSRAPDPRTLTPPH 97 + PP R R PV PP P PR ++PPH Sbjct: 1285 MPHPPDRRRQPVSPP------PPPRPISPPH 1309
>LATS1_MOUSE (Q8BYR2) Serine/threonine-protein kinase LATS1 (EC 2.7.11.1) (Large| tumor suppressor homolog 1) (WARTS protein kinase) Length = 1129 Score = 30.8 bits (68), Expect = 0.95 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 14 PPRRDRSPVLPPRPHSRAPDPRTLTPP 94 PP + RS PP P + P PR TPP Sbjct: 238 PPPQVRSVTPPPPPRGQTPPPRGTTPP 264
>XYLS_SULSO (Q9P999) Alpha-xylosidase (EC 3.2.1.-)| Length = 731 Score = 30.8 bits (68), Expect = 0.95 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 152 EQETRRHAGERASGLVGWHAGGSGFGDLELASVDGAG 42 EQE GER GL G HAGG+G G +D +G Sbjct: 103 EQEFELSEGERVYGL-GQHAGGNGLGQSSAYKLDYSG 138
>LATS1_HUMAN (O95835) Serine/threonine-protein kinase LATS1 (EC 2.7.11.1) (Large| tumor suppressor homolog 1) (WARTS protein kinase) (h-warts) Length = 1130 Score = 30.8 bits (68), Expect = 0.95 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 14 PPRRDRSPVLPPRPHSRAPDPRTLTPP 94 PP + RS PP P + P PR TPP Sbjct: 238 PPPQVRSVTPPPPPRGQTPPPRGTTPP 264
>Y4BJ_RHISN (P55377) Hypothetical 67.9 kDa protein y4bJ| Length = 630 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -1 Query: 89 GSGFGDLELASVDGAGARENDLDGEG 12 G+G+ +E A++DG G R D+DG+G Sbjct: 226 GNGWTSIEGATLDGGGYRLQDIDGDG 251
>MUCDL_MOUSE (Q8VHF2) Mucin and cadherin-like protein precursor| (Mu-protocadherin) Length = 831 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 17 PRRDRSPVLPPRPHSRAPDPRTLTPPHAIPLA 112 P+ + P+ PP P S +P P + TPP P A Sbjct: 710 PKLAQPPLRPPSPMSSSPTPPSSTPPSPQPKA 741
>LAMBV_CHICK (Q01636) Laminin beta-1 chain variant (Laminin beta-1-2 chain)| (Fragment) Length = 198 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 8 ARPPRRDRSPVLPPRPHSRAPDPRTLTPPHAIP 106 A PP R P P R PDP + PPHA P Sbjct: 17 ATPPTHAR-----PDPTRRHPDPESRAPPHARP 44
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 26.6 bits (57), Expect(2) = 2.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 11 RPPRRDRSPVLPPRPHSRAPDPRTLTPP 94 RPP +P +PP P S P P TPP Sbjct: 277 RPPFPANTP-MPPSPPSPPPSPAPPTPP 303 Score = 21.2 bits (43), Expect(2) = 2.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 73 SPNPDPPACHPTSPLARSP 129 SP P PP+ P SP P Sbjct: 317 SPAPVPPSPAPPSPAPSPP 335
>CWC22_CRYNE (Q5KFX4) Pre-mRNA-splicing factor CWC22| Length = 831 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +2 Query: 23 RDRSPVL-PPRPHSRAPDPRTLTP 91 R RSP L PPRP SR+ R+LTP Sbjct: 12 RPRSPSLSPPRPDSRSSRGRSLTP 35 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 6/33 (18%) Frame = +2 Query: 14 PPRR------DRSPVLPPRPHSRAPDPRTLTPP 94 PPRR RSP PPR + +PR+ +PP Sbjct: 717 PPRRRRYSSDSRSPSPPPRRRQYSDEPRSPSPP 749
>PEXLP_TOBAC (Q03211) Pistil-specific extensin-like protein precursor (PELP)| Length = 426 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 14 PPRRDRSPVLPPRPHSRAPDPRTLTPPHA 100 PPR +SP+LPP P P T +P A Sbjct: 223 PPRAKKSPLLPPPPPVAYPPVMTPSPSPA 251
>ENV2_MOUSE (P11370) Retrovirus-related Env polyprotein from Fv-4 locus| Length = 679 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 11 RPPRRDRSPVLPPRPHSRAPDPRTLTPPHAIPL 109 RPP R P PP P + P LTPP PL Sbjct: 278 RPPSRP-VPARPPPPSNSTPTGDPLTPPTGDPL 309
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.1 bits (61), Expect = 6.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +2 Query: 14 PPRRDRSPVLPPRPHSRAPDP---RTLTP---PHAIPLAR 115 PP RD SP P + +P P R+L+P PH+ P +R Sbjct: 45 PPSRDPSPYRSPGERTPSPSPRRDRSLSPRDQPHSHPRSR 84
>ZDHC8_MOUSE (Q5Y5T5) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) Length = 762 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 11 RPPRRDRSPVLPPRPHSRAP 70 RPP R SPVL PRP +P Sbjct: 516 RPPPRSFSPVLGPRPREPSP 535
>STP2_RAT (P11101) Nuclear transition protein 2 (TP-2) (TP2)| Length = 114 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 61 ASSRSPNPDPPACHPTSPL 117 +SS SP+P PP HP +P+ Sbjct: 45 SSSSSPSPGPPTKHPKTPM 63
>TCRG1_HUMAN (O14776) Transcription elongation regulator 1 (TATA box-binding| protein-associated factor 2S) (Transcription factor CA150) Length = 1098 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 14 PPRRDRSPVLPPRPHSRAPDPRTLTPPHAIPL 109 PP R P +PP S P P + PP P+ Sbjct: 91 PPHLQRPPFMPPPMSSMPPPPGMMFPPGMPPV 122
>ROBO1_HUMAN (Q9Y6N7) Roundabout homolog 1 precursor (H-Robo-1) (Deleted in U| twenty twenty) Length = 1651 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 17 PRRDRSPVLPPRPHSRAPDPRTLTPPH 97 P R R PV PP P PR ++PPH Sbjct: 1289 PDRRRQPVSPP------PPPRPISPPH 1309
>RAPH1_HUMAN (Q70E73) Ras-associated and pleckstrin homology domains-containing| protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein) Length = 1302 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 14 PPRRDRSPVLPPRPHSRAPDPRTLTPPHAIP 106 PP + S V PP P S P P PP A P Sbjct: 970 PPPPESSLVFPPPPPSPVPAPPPPPPPTASP 1000
>SMRC2_HUMAN (Q8TAQ2) SWI/SNF-related matrix-associated actin-dependent regulator| of chromatin subfamily C member 2 (SWI/SNF complex 170 kDa subunit) (BRG1-associated factor 170) Length = 1214 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 38 VLPPRPHSRAPDPRTLTPPHAIP 106 V PP PH +P P TPP +P Sbjct: 1040 VPPPGPHGPSPFPNQQTPPSMMP 1062
>P85B_HUMAN (O00459) Phosphatidylinositol 3-kinase regulatory beta subunit| (PI3-kinase p85-beta subunit) (PtdIns-3-kinase p85-beta) Length = 728 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 5 LARPPRRDRSP-VLPPRPHSRAPDPRTLTP 91 LARP R R P LP RP AP+P P Sbjct: 83 LARPGPRPRGPRPLPARPRDGAPEPGLTLP 112
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +2 Query: 14 PPRRDRSPVLPPRPHSRAP--DPRTLTPPHAIP 106 PP ++ P++ P PH + P +P PP A P Sbjct: 6 PPPHEKPPIVHPPPHEKPPLFEPPFEKPPPAHP 38
>CUD1_SCHGR (Q7M4F4) Endocuticle structural glycoprotein SgAbd-1| Length = 184 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +2 Query: 11 RPPRRDRSPVLPPRPHSRA----PDPRTLTPPHAIP 106 R PR +PV P P SRA P PR + P +P Sbjct: 17 RIPRPSATPVRPSPPASRAPPPPPPPRPVVPSQPLP 52
>TBX9_CAEEL (Q22289) T-box transcription factor tbx-9| Length = 292 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 20 RRDRSPVLPPRPHSRAPDPRTLTPPHAIPL 109 R+ RSP +S++P P++ +PP PL Sbjct: 199 RKRRSPSYSDGSNSQSPSPKSRSPPEVAPL 228
>POLR_EPMV (P20126) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1839 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 79 NPDPPACHPTSPLARSP 129 NP PP+ HP +PLA P Sbjct: 717 NPTPPSSHPFTPLADDP 733 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.125 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,633,545 Number of Sequences: 219361 Number of extensions: 402720 Number of successful extensions: 2821 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 2226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2776 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)