| Clone Name | bastl17c08 |
|---|---|
| Clone Library Name | barley_pub |
>PO3F2_HUMAN (P20265) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 443 Score = 30.8 bits (68), Expect = 1.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 10 PDSASHHPYPATQPDSRPPP 69 P A HHP+P + P +PPP Sbjct: 222 PHHADHHPHPHSHPHQQPPP 241
>PO3F2_RAT (P56222) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 445 Score = 30.8 bits (68), Expect = 1.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 10 PDSASHHPYPATQPDSRPPP 69 P A HHP+P + P +PPP Sbjct: 224 PHHADHHPHPHSHPHQQPPP 243
>PO3F2_MOUSE (P31360) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 445 Score = 30.8 bits (68), Expect = 1.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 10 PDSASHHPYPATQPDSRPPP 69 P A HHP+P + P +PPP Sbjct: 224 PHHADHHPHPHSHPHQQPPP 243
>BRD4_MOUSE (Q9ESU6) Bromodomain-containing protein 4 (Mitotic| chromosome-associated protein) (MCAP) Length = 1400 Score = 29.6 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 7 PPDSASHHPYPATQPD--SRPPPGTLDRTDPCQ 99 PP A+ HP+PA PD ++PP T+ P Q Sbjct: 217 PPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQ 249
>YHC4_YEAST (P38741) Hypothetical 80.1 kDa protein in SNF6-SPO11 intergenic| region Length = 713 Score = 28.9 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 16 SASHHPYPATQPDSRPPPGTLD 81 + +HHPY P S PPP LD Sbjct: 645 AGNHHPYMMVYPMSPPPPSGLD 666
>RGDSR_HUMAN (Q8IZJ4) Ral-GDS-related protein (hRGR)| Length = 473 Score = 27.7 bits (60), Expect = 9.5 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 7/39 (17%) Frame = +1 Query: 7 PPDSASHHPYPATQPDSRPPPGTL-------DRTDPCQG 102 PP P PA P PPPGT+ + + PC+G Sbjct: 164 PPGYLHSAPGPAPAPGEGPPPGTVLEPQSAPESSCPCRG 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.136 0.465 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,641,508 Number of Sequences: 219361 Number of extensions: 238297 Number of successful extensions: 1596 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1586 length of database: 80,573,946 effective HSP length: 10 effective length of database: 78,380,336 effective search space used: 1881128064 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)