| Clone Name | bastl16g04 |
|---|---|
| Clone Library Name | barley_pub |
>GPC2_HUMAN (Q8N158) Glypican-2 precursor| Length = 579 Score = 31.2 bits (69), Expect = 0.73 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -1 Query: 202 ASGSGGERERESPRLASATLFLLPRD*APQNPNPPRRGED*NKGGSG 62 ASGSGG ++ +A A + P P+ P PPRR KGG G Sbjct: 499 ASGSGGGQQYADDWMAGA---VAPPARPPRPPYPPRRDGSGGKGGGG 542
>SC10A_MOUSE (Q6QIY3) Sodium channel protein type 10 alpha subunit (Sodium| channel protein type X alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.8) (Peripheral nerve sodium channel 3) (Sensory neuron sodium channel) Length = 1958 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -1 Query: 136 LPRD*APQNPNP-PRRGED*NKG 71 LPR PQ+PNP PRRGE+ +G Sbjct: 548 LPRSPLPQSPNPGPRRGEEGQRG 570
>Y4QF_RHISN (P55627) Probable peptidase y4qF (EC 3.4.21.-)| Length = 754 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 177 SLSPPLPEAQPRIRV 221 SL PPLP A+PRIRV Sbjct: 36 SLRPPLPRAEPRIRV 50
>BTNL2_RAT (Q6MG97) Butyrophilin-like protein 2 precursor| Length = 454 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 79 SNPPLAVEG*GFEGPNLVVVERGW 150 S+P + VEG G EG LV RGW Sbjct: 146 SSPNIHVEGPGEEGVQLVCTSRGW 169
>GPC2_RAT (P51653) Glypican-2 precursor (Cerebroglycan) (HSPG M13)| Length = 579 Score = 28.5 bits (62), Expect = 4.7 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -1 Query: 202 ASGSGGERERESPRLASATLFLLPRD*APQNPNPPRRGED*NKGGSG 62 ASGSGG ++ A A + P P+ P PPRR +GGSG Sbjct: 497 ASGSGGGQQYADDWKAGAAPVVPPAR-PPRPPRPPRRDGLGVRGGSG 542
>GPC2_MOUSE (Q8BKV1) Glypican-2 precursor| Length = 579 Score = 28.5 bits (62), Expect = 4.7 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -1 Query: 202 ASGSGGERERESPRLASATLFLLPRD*APQNPNPPRRGED*NKGGSG 62 ASGSGG ++ A A + P P+ P PPRR +GGSG Sbjct: 497 ASGSGGGQQYADDWKAGAVPVVPPAR-PPRPPRPPRRDGLGVRGGSG 542
>E13B_SOYBN (P52395) Glucan endo-1,3-beta-glucosidase (EC 3.2.1.39)| ((1->3)-beta-glucan endohydrolase) ((1->3)-beta-glucanase) (Beta-1,3-endoglucanase) (Fragment) Length = 255 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 94 AVEG*GFEGPNLVVVERGWPRRGGATLSL 180 A+E G +VV E GWP GGA S+ Sbjct: 168 ALENVGASNLQIVVSESGWPSEGGAGASI 196
>E13A_SOYBN (Q03773) Glucan endo-1,3-beta-glucosidase precursor (EC 3.2.1.39)| ((1->3)-beta-glucan endohydrolase) ((1->3)-beta-glucanase) (Beta-1,3-endoglucanase) Length = 347 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 94 AVEG*GFEGPNLVVVERGWPRRGGATLSL 180 A+E G N+VV E GWP GG SL Sbjct: 255 ALEKAGGGSLNIVVSESGWPSSGGTATSL 283
>104K_THEPA (P15711) 104 kDa microneme-rhoptry antigen precursor (p104)| Length = 924 Score = 28.1 bits (61), Expect = 6.1 Identities = 23/79 (29%), Positives = 32/79 (40%), Gaps = 21/79 (26%) Frame = -1 Query: 265 PRSQKGPRPGSAHLATRILGCASGSGGE------------RERESPRLASAT-------- 146 P S K P P H ++I + G R+ +SPR AS T Sbjct: 547 PGSGKKPGPAREHKPSKIPTLSKKPSGPKDPKHPRDPKEPRKSKSPRTASPTRRPSPKLP 606 Query: 145 -LFLLPRD*APQNPNPPRR 92 L LP+ +P++P PP R Sbjct: 607 QLSKLPKSTSPRSPPPPTR 625
>MYST3_MOUSE (Q8BZ21) Histone acetyltransferase MYST3 (EC 2.3.1.48) (EC 2.3.1.-)| (MYST protein 3) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3) (Monocytic leukemia zinc finger protein) (Monocytic leukemia zinc finger homolog) Length = 2003 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -1 Query: 184 ERERESPRLASATLF---LLPRD*APQNPNPPRRG 89 +++ E LAS++ LPRD P N PPRRG Sbjct: 834 DKKPEVKELASSSRLSKQALPRDSLPANSQPPRRG 868 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,859,779 Number of Sequences: 219361 Number of extensions: 510653 Number of successful extensions: 1393 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1393 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)