| Clone Name | bastl16f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1242_PHOLL (Q7N7B3) UPF0255 protein plu1242 | 27 | 9.2 | 2 | CCNA1_HUMAN (P78396) Cyclin-A1 | 27 | 9.2 | 3 | MDC1_MOUSE (Q5PSV9) Mediator of DNA damage checkpoint protein 1 | 27 | 9.2 | 4 | SYFB_SYNEL (Q8DL37) Phenylalanyl-tRNA synthetase beta chain (EC ... | 27 | 9.2 |
|---|
>Y1242_PHOLL (Q7N7B3) UPF0255 protein plu1242| Length = 415 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 333 RGTWPCAVPHQTRCWPQRQQRAPCVPETA*SSWLELDRRQS*VHHP 196 +G W HQ W QR +A +PE + + WL+ S +P Sbjct: 94 KGNWVFEWSHQAMLWQQRALQAEQIPEAS-NFWLKAANLYSIAGYP 138
>CCNA1_HUMAN (P78396) Cyclin-A1| Length = 465 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 80 GAQPPKSAARSLSRPRGSYQRHAGKGLTR 166 G PP+ L G Y+R G+G+TR Sbjct: 75 GQDPPQRTVLGLLTANGQYRRTCGQGITR 103
>MDC1_MOUSE (Q5PSV9) Mediator of DNA damage checkpoint protein 1| Length = 1707 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 223 SATELSTSPDCNPPVPISCSC*PLP 149 SA+ +S++PD PPVPI+ P P Sbjct: 1368 SASPVSSTPDLKPPVPIAQPVTPEP 1392
>SYFB_SYNEL (Q8DL37) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 821 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +1 Query: 76 ARSPAAQVGCPLAQPTPRIVPEARREGANKSS*LELVD---CNRVMYLALSPIQLKPA 240 AR AA G PL PTPR + ++ GA L + D C ++ +Q+ P+ Sbjct: 177 AREVAALTGAPLTLPTPRAI-APKKSGAKGPVQLAIADPQACPAYCGTLITHVQIAPS 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,670,029 Number of Sequences: 219361 Number of extensions: 695010 Number of successful extensions: 2126 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2125 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)