| Clone Name | bastl16f04 |
|---|---|
| Clone Library Name | barley_pub |
>BMS1_SCHPO (O94653) Ribosome biogenesis protein BMS1 homolog| Length = 1121 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = +1 Query: 247 NPKAFAFRSATKAKRLQSRSAEIEQRRLHVPIMDRSIGE 363 NPKAFA SA + R R+A+I Q++LHVP++DR+ E Sbjct: 32 NPKAFAVASAGRMARQAMRTADISQKKLHVPMVDRTPDE 70
>BMS1_YEAST (Q08965) Ribosome biogenesis protein BMS1| Length = 1183 Score = 40.0 bits (92), Expect = 0.001 Identities = 23/71 (32%), Positives = 33/71 (46%) Frame = +1 Query: 142 VEQPRKAHRVAKSXXXXXXXXXXXXXXXXXXXXXXNPKAFAFRSATKAKRLQSRSAEIEQ 321 +EQ K HR AK N KAFA + K R RS+++ + Sbjct: 1 MEQSNKQHRKAKEKNTAKKKLHTQGH---------NAKAFAVAAPGKMARTMQRSSDVNE 51 Query: 322 RRLHVPIMDRS 354 R+LHVP++DR+ Sbjct: 52 RKLHVPMVDRT 62
>BMS1_HUMAN (Q14692) Ribosome biogenesis protein BMS1 homolog| Length = 1282 Score = 36.6 bits (83), Expect = 0.015 Identities = 14/36 (38%), Positives = 26/36 (72%) Frame = +1 Query: 247 NPKAFAFRSATKAKRLQSRSAEIEQRRLHVPIMDRS 354 NPKAFA +SA + R R+ +++ ++ H+P++DR+ Sbjct: 41 NPKAFAVQSAVRMARSFHRTQDLKTKKHHIPVVDRT 76
>PRIM_PSEAE (Q9I5W0) DNA primase (EC 2.7.7.-)| Length = 664 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 138 GFPRSHGEEDFAEAVLAGFLRRRRGMAAGKEESGGRG 28 GF H + +F +AV L +R GM +EE GGRG Sbjct: 72 GFVMDHDQLEFPQAVEE--LAKRAGMDVPREERGGRG 106
>ATRX_MOUSE (Q61687) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked nuclear protein) (Heterochromatin protein 2) (HP1 alpha-interacting protein) (HP1-BP38 protein) Length = 2476 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Frame = +1 Query: 82 KPR-EHRLRKILLTMAPGEAGVEQPR--KAHRVAK 177 KPR HRL + LT++ GE+G E+P K H+ AK Sbjct: 1320 KPRYRHRLLRHKLTLSDGESGEEKPTKPKEHKEAK 1354
>TNR11_HUMAN (Q9Y6Q6) Tumor necrosis factor receptor superfamily member 11A| precursor (Receptor activator of NF-KB) (Osteoclast differentiation factor receptor) (ODFR) (CD265 antigen) Length = 616 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 285 EAATISISGN*TTPSPCANHGSLNWGTTSFCCR 383 +A ++GN TTP CA +W CCR Sbjct: 96 KALVAVVAGNSTTPRRCACTAGYHWSQDCECCR 128
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 258 FCLPFSNKSEA-ATISISGN*TTPSPCANHGSLNW 359 +C F+NK++ T+ + N T+PS C G NW Sbjct: 302 WCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNW 336 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,325,350 Number of Sequences: 219361 Number of extensions: 507737 Number of successful extensions: 1553 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1553 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)