| Clone Name | bastl16e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CLCD_RHOOP (O67988) Carboxymethylenebutenolidase (EC 3.1.1.45) (... | 28 | 7.5 | 2 | ODPX_HUMAN (O00330) Pyruvate dehydrogenase protein X component, ... | 28 | 7.5 | 3 | PTH_YEAST (P38876) Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH) | 27 | 9.8 |
|---|
>CLCD_RHOOP (O67988) Carboxymethylenebutenolidase (EC 3.1.1.45) (Dienelactone| hydrolase) (DLH) Length = 252 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 54 HHQTPAPTAHLAISGDRRRCPGLDPNPY 137 H+++ AP IS + R PG DP PY Sbjct: 3 HNKSSAPPTPAHISIQQNRTPGTDPVPY 30
>ODPX_HUMAN (O00330) Pyruvate dehydrogenase protein X component, mitochondrial| precursor (Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex) (Lipoyl-containing pyruvate dehydrogenase complex component X) (E3-binding protein) Length = 501 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 9 ALNPIR*RKSGKQTSHHQTPAPTAHLAISGDRRRCPGLD-PNPYPAPITTRG 161 AL ++ +++GK T TPAPTA + G P P P++T G Sbjct: 216 ALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPG 267
>PTH_YEAST (P38876) Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)| Length = 190 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 133 GLGSRPGQRRRSP-EMARWAVGA 68 G+G PG R R P ++RW +GA Sbjct: 142 GIGREPGSRSRDPASVSRWVLGA 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,288,455 Number of Sequences: 219361 Number of extensions: 403220 Number of successful extensions: 1297 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1295 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)