| Clone Name | bastl16e05 |
|---|---|
| Clone Library Name | barley_pub |
>NIFS_FRASE (Q9Z5X5) Cysteine desulfurase (EC 2.8.1.7) (Nitrogenase| metalloclusters biosynthesis protein nifS) Length = 419 Score = 31.6 bits (70), Expect = 0.47 Identities = 25/73 (34%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +3 Query: 114 RPEDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDHTGRSFGTYPAVLLYRPRS 293 RP E+ AG RCC D T AL R PV + TG A LY P+ Sbjct: 166 RPLVEAARSAG------RCCCADVTQ-----ALGRVPVEFERTGVDLAVSSAHKLYGPKG 214 Query: 294 VS---LQKIKWPR 323 V K W R Sbjct: 215 VGALIASKDAWSR 227
>VTI13_ARATH (Q9LVP9) Vesicle transport v-SNARE 13 (AtVTI13) (Vesicle transport| v-SNARE protein VTI13) (Vesicle soluble NSF attachment protein receptor 13) Length = 221 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 254 ERTTSVIKSDGSPRERKACEICSGVEKAAALTR 156 ++ TS I DG +++ EI SGVE+A AL + Sbjct: 21 KKCTSAIALDGEQKKQNLSEIKSGVEEAEALVK 53
>ACDD2_METAC (Q8TJC2) Acetyl-CoA decarbonylase/synthase complex delta subunit 2| (ACDS complex delta subunit 2) (Corrinoid/iron-sulfur component small subunit 2) Length = 436 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 120 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 239 + E +++A VS +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLARAAEVSEGERCLLASASLNLDYAAIAEAALKYDH 278
>ACDD1_METAC (Q8TRZ8) Acetyl-CoA decarbonylase/synthase complex delta subunit 1| (ACDS complex delta subunit 1) (Corrinoid/iron-sulfur component small subunit 1) Length = 436 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 120 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 239 + E +++A VS +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLARAAEVSEGERCLLASASLNLDYAAIAEAALKYDH 278
>VTI11_ARATH (Q9SEL6) Vesicle transport v-SNARE 11 (AtVTI11) (Vesicle transport| v-SNARE protein VTI1a) (Vesicle soluble NSF attachment protein receptor VTI1a) (AtVTI1a) Length = 221 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 254 ERTTSVIKSDGSPRERKACEICSGVEKAAALTR 156 ++ +S I DG +++K EI SG+E A L R Sbjct: 21 KKCSSAISLDGEQKKQKLSEIKSGLENAEVLIR 53
>MEGF8_MOUSE (P60882) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2330 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 178 STPLQISHALRSRGLPSDLITLVVRSGRTLLSCSIG 285 STP +S+ L G P L T VV+S R+L++ G Sbjct: 874 STPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCG 909
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 178 STPLQISHALRSRGLPSDLITLVVRSGRTLLSCSIG 285 STP +S+ L G P L T VV+S R+L++ G Sbjct: 874 STPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCG 909
>ODO1_ECOLI (P0AFG3) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2)| (Alpha-ketoglutarate dehydrogenase) Length = 933 Score = 27.7 bits (60), Expect = 6.8 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +1 Query: 178 STPLQISHALRSRGLPSDLITLVVRSGRTLLSCSIGHDLLVSKRSNGRGGT 330 STP Q+ H LR + L LVV S ++LL H L VS GT Sbjct: 752 STPAQVYHMLRRQALRGMRRPLVVMSPKSLLR----HPLAVSSLEELANGT 798
>ODO1_ECOL6 (P0AFG4) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2)| (Alpha-ketoglutarate dehydrogenase) Length = 933 Score = 27.7 bits (60), Expect = 6.8 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +1 Query: 178 STPLQISHALRSRGLPSDLITLVVRSGRTLLSCSIGHDLLVSKRSNGRGGT 330 STP Q+ H LR + L LVV S ++LL H L VS GT Sbjct: 752 STPAQVYHMLRRQALRGMRRPLVVMSPKSLLR----HPLAVSSLEELANGT 798
>ODO1_ECO57 (P0AFG5) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2)| (Alpha-ketoglutarate dehydrogenase) Length = 933 Score = 27.7 bits (60), Expect = 6.8 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +1 Query: 178 STPLQISHALRSRGLPSDLITLVVRSGRTLLSCSIGHDLLVSKRSNGRGGT 330 STP Q+ H LR + L LVV S ++LL H L VS GT Sbjct: 752 STPAQVYHMLRRQALRGMRRPLVVMSPKSLLR----HPLAVSSLEELANGT 798
>METK_BUCAI (P57486) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) (MAT) Length = 378 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 75 EHELNRRNIHPWLRPEDES 131 + EL ++NI PWLRP+ +S Sbjct: 149 QSELRKKNILPWLRPDAKS 167
>Y130_MYCGE (P47376) UPF0144 protein MG130| Length = 484 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 193 ISHALRSRGLPSDLITLVVRSGRTLLSCSIGHDLLVSKRSNGR 321 +SH+L + L + L L+ L C + HD+ S NG+ Sbjct: 294 LSHSLETAFLTAHLAALIELDSELSLKCGLLHDIGKSNDDNGK 336
>FPG_MYCGE (P55825) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)| (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM) Length = 283 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +1 Query: 274 CSIGHDLLVSKRSNGRGGTHC--CHK 345 CS+ + L+V K+ NGRG C C K Sbjct: 247 CSVCNQLIVKKKINGRGSYFCLNCQK 272
>ACDD_METMA (Q8PRQ5) Acetyl-CoA decarbonylase/synthase complex delta subunit| (ACDS complex delta subunit) (Corrinoid/iron-sulfur component small subunit) Length = 436 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +3 Query: 120 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 239 + E +++A V+ +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLARAAEVAEGERCLLASASLNLDYAAIAEAALKYDH 278
>ACDD1_METTE (Q50538) Acetyl-CoA decarbonylase/synthase complex delta subunit 1| (ACDS complex delta subunit 1) (Corrinoid/iron-sulfur component small subunit 1) Length = 436 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +3 Query: 120 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 239 + E +++A V+ +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLAKAAEVAEGERCLLASASLNLDYAAIAEAALKYDH 278
>SPTN4_HUMAN (Q9H254) Spectrin beta chain, brain 3 (Spectrin, non-erythroid beta| chain 3) (Beta-IV spectrin) Length = 2564 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 329 VPPRPFDLLETNRSWPIEQDSRVRPERTTSVIKSDGSPRERK 204 +P P D ET + + R RPER S +++ PR R+ Sbjct: 2207 LPAAPEDAAETPATPAAAEQVRPRPERQESADRAEELPRRRR 2248
>MCM2_DROME (P49735) DNA replication licensing factor Mcm2 (Minichromosome| maintenance 2 protein) (DmMCM2) Length = 887 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +3 Query: 78 HELNRRNIHPWLRPEDESVSQAGLVSSRQRCCLLDSTAD 194 ++ +R +IH + + S+S+AG+V+S Q C + + A+ Sbjct: 578 NDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAAN 616
>DED1_USTMA (Q4P733) ATP-dependent RNA helicase DED1 (EC 3.6.1.-)| Length = 672 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 13/58 (22%) Frame = +1 Query: 181 TPLQISHALRSRGL-------------PSDLITLVVRSGRTLLSCSIGHDLLVSKRSN 315 TP+ ++ A+ +RGL PSD+ V R GRT + ++GH R N Sbjct: 501 TPIMVATAVAARGLDIPNVTHVVNYDLPSDVDDYVHRIGRTGRAGNVGHATAFFNRGN 558
>MCM2_MOUSE (P97310) DNA replication licensing factor MCM2 (Minichromosome| maintenance protein 2 homolog) (Nuclear protein BM28) Length = 904 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +3 Query: 78 HELNRRNIHPWLRPEDESVSQAGLVSSRQRCCLLDSTAD 194 ++ +R +IH + + S+S+AG+V+S Q C + + A+ Sbjct: 593 NDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAAN 631
>MCM2_HUMAN (P49736) DNA replication licensing factor MCM2 (Minichromosome| maintenance protein 2 homolog) (Nuclear protein BM28) Length = 904 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +3 Query: 78 HELNRRNIHPWLRPEDESVSQAGLVSSRQRCCLLDSTAD 194 ++ +R +IH + + S+S+AG+V+S Q C + + A+ Sbjct: 593 NDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAAN 631
>DUET_HUMAN (Q9Y2A5) Serine/threonine-protein kinase Duet (EC 2.7.11.1)| (Serine/threonine kinase with Dbl- and pleckstrin homology domain) Length = 1289 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 102 HPWLRPEDESVSQAGLVSSRQRC 170 HPWL+P + S S+ L +SR C Sbjct: 1238 HPWLQPHNGSYSKIPLDTSRLAC 1260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,917,200 Number of Sequences: 219361 Number of extensions: 897156 Number of successful extensions: 2218 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2217 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)