| Clone Name | bastl16d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VPS41_LYCES (P93231) Vacuolar assembly protein VPS41 homolog | 47 | 2e-05 | 2 | VPS41_ARATH (P93043) Vacuolar assembly protein VPS41 homolog | 33 | 0.20 | 3 | VPS41_HUMAN (P49754) Vacuolar assembly protein VPS41 homolog (S53) | 33 | 0.35 | 4 | KIRR2_HUMAN (Q6UWL6) Kin of IRRE-like protein 2 precursor (Kin o... | 29 | 3.8 |
|---|
>VPS41_LYCES (P93231) Vacuolar assembly protein VPS41 homolog| Length = 960 Score = 47.0 bits (110), Expect = 2e-05 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 275 RLKYQRLGGSVPXXXXXXXXXXXXXXXXXXXLGTHDGTLHILDFQGN 415 RLKYQR+G SVP LGTH G +HILDF GN Sbjct: 37 RLKYQRMGASVPSLLSADAATCIAVAERMIALGTHGGAVHILDFLGN 83
>VPS41_ARATH (P93043) Vacuolar assembly protein VPS41 homolog| Length = 976 Score = 33.5 bits (75), Expect = 0.20 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 275 RLKYQRLGGSVPXXXXXXXXXXXXXXXXXXXLGTHD 382 RLKYQR+GG+VP LGTHD Sbjct: 43 RLKYQRMGGNVPALLSNDAASCIAVAARMIALGTHD 78
>VPS41_HUMAN (P49754) Vacuolar assembly protein VPS41 homolog (S53)| Length = 854 Score = 32.7 bits (73), Expect = 0.35 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +2 Query: 275 RLKYQRLGGSVPXXXXXXXXXXXXXXXXXXXLGTHDGTLHILDFQGN 415 +LKY+RL V LGTH G +++LD QGN Sbjct: 29 KLKYERLSNGVTEILQKDAASCMTVHDKFLALGTHYGKVYLLDVQGN 75
>KIRR2_HUMAN (Q6UWL6) Kin of IRRE-like protein 2 precursor (Kin of irregular| chiasm-like protein 2) (Nephrin-like protein 3) Length = 708 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 43 TFYGFNPHISRIPPWGRDLAAVAVISLLSPRS 138 TFY FNPH+ +PP A ++ PR+ Sbjct: 638 TFYDFNPHLGMVPPCRLYRARAGYLTTPHPRA 669 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,628,083 Number of Sequences: 219361 Number of extensions: 403682 Number of successful extensions: 1207 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1206 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)