| Clone Name | bastl16d07 |
|---|---|
| Clone Library Name | barley_pub |
>TREF1_HUMAN (Q96PN7) Transcriptional-regulating factor 1| (Transcriptional-regulating protein 132) (Zinc finger transcription factor TReP-132) (Zinc finger protein rapa) Length = 1200 Score = 30.0 bits (66), Expect = 3.1 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 112 NSAHKGGADKVFASPVPPH-PSRTQDPTGLDLGLQGEG 222 N+ GG D ASP+ PH P T+D GL +G + G Sbjct: 38 NAVTGGGMDAPQASPISPHFPQDTRDGLGLPVGSKNLG 75
>IF2_SILPO (Q5LWL4) Translation initiation factor IF-2| Length = 835 Score = 30.0 bits (66), Expect = 3.1 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -2 Query: 147 EDLIRAALVSGVRKEAWAGRRSSASREEAPAPGGGDGVRR---RDSER 13 E+ RAA+ + +EA RS+ A P GGD RR RD ER Sbjct: 143 EEAKRAAVRAAAEQEAPKAERSAERAPAAARPEGGDNARRTTDRDRER 190
>GUNG_CLOTM (Q05332) Endoglucanase G precursor (EC 3.2.1.4) (Egg)| (Endo-1,4-beta-glucanase) (Cellulase G) Length = 566 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 231 ASATMEAADLATDGRIFKADFTDSGAYQLR 320 ASA M+AAD+ DG++ D+T Y LR Sbjct: 528 ASANMDAADVNADGKVNSTDYTVLKRYLLR 557
>FRDA_HELPY (O06913) Fumarate reductase flavoprotein subunit (EC 1.3.99.1)| Length = 714 Score = 29.6 bits (65), Expect = 4.0 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 309 YQLRERMREKLREFKGSAEVADYVIVLLRNGKREDEARKELR 434 Y++RERM+E V D + + R GKR +EA KEL+ Sbjct: 491 YEIRERMKE----------VMDEKVGVFREGKRLEEALKELQ 522
>FRDA_HELPJ (Q9ZMP0) Fumarate reductase flavoprotein subunit (EC 1.3.99.1)| Length = 714 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 309 YQLRERMREKLREFKGSAEVADYVIVLLRNGKREDEARKELR 434 Y++RERM+E V D + + R GK+ +EA KEL+ Sbjct: 491 YEIRERMKE----------VMDEKVGVFREGKKLEEALKELQ 522
>DP2L_THEVO (Q97CR6) DNA polymerase II large subunit (EC 2.7.7.7) (Pol II)| Length = 1088 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +3 Query: 246 EAADLATDGRIFKADFTDSGAYQLRERMREKLREFKGSAEVADYVIVLLRNGKRED 413 E DLA+ R D TD L M E++ G + +AD + L + RE+ Sbjct: 28 ECFDLASQARELGMDVTDKVEIPLASDMAERIEALIGISGIADQIRDLSKKMSREE 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,784,908 Number of Sequences: 219361 Number of extensions: 692977 Number of successful extensions: 3617 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3613 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)