| Clone Name | bastl16c04 |
|---|---|
| Clone Library Name | barley_pub |
>HDA4_CAEBR (Q613L4) Histone deacetylase 4| Length = 892 Score = 30.8 bits (68), Expect = 1.9 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -3 Query: 443 LEYAGHATHLAAVDSRHVVSQGVEHPPRRGHHPTLPNRSNAGPDENR 303 L A T+L + + ++ + V P + HHPTLP + + P +R Sbjct: 131 LSLANSLTNLLSSSNGNLSNLSVPQTPTKEHHPTLPPQQPSAPTSSR 177
>RSMB_ERIEU (Q9TU67) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 30.0 bits (66), Expect = 3.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 398 GSRPPPDGLHGRHIPDLRPP 457 G RPPP G+ G P LRPP Sbjct: 219 GMRPPPPGMRGPPPPGLRPP 238
>RSMN_RAT (P63164) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) Length = 240 Score = 29.3 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 398 GSRPPPDGLHGRHIPDLRPP 457 G RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMN_MOUSE (P63163) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 29.3 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 398 GSRPPPDGLHGRHIPDLRPP 457 G RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMN_HUMAN (P63162) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 29.3 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 398 GSRPPPDGLHGRHIPDLRPP 457 G RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMB_MONDO (Q9TU66) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 29.3 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 398 GSRPPPDGLHGRHIPDLRPP 457 G RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>RSMB_HUMAN (P14678) Small nuclear ribonucleoprotein-associated proteins B and| B' (snRNP-B) (Sm protein B/B') (Sm-B/Sm-B') (SmB/SmB') Length = 240 Score = 29.3 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 398 GSRPPPDGLHGRHIPDLRPP 457 G RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>RSMB_CHICK (Q9PV94) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 29.3 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 398 GSRPPPDGLHGRHIPDLRPP 457 G RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>SC24C_ARATH (Q9M291) Protein transport protein Sec24-like CEF| Length = 1097 Score = 28.9 bits (63), Expect = 7.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 407 PPPDGLHGRHIPDLRPPADAHGAS 478 PPP G+HG H+ + PP+ G + Sbjct: 197 PPPSGMHGGHLSNGPPPSGMPGGT 220
>BIOH_VIBVY (Q7MPY0) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 28.5 bits (62), Expect = 9.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 458 LAVEDLEYAGHATHLAAVDSRHVVSQGVEHPPRR 357 L V DL GH+ HL A + Q +EH P++ Sbjct: 42 LHVVDLPGYGHSAHLHAASLEEIAQQLLEHAPKQ 75
>BIOH_VIBVU (Q8DDU4) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 28.5 bits (62), Expect = 9.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 458 LAVEDLEYAGHATHLAAVDSRHVVSQGVEHPPRR 357 L V DL GH+ HL A + Q +EH P++ Sbjct: 42 LHVVDLPGYGHSAHLHAASLEEIAQQLLEHAPKQ 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,838,334 Number of Sequences: 219361 Number of extensions: 1085532 Number of successful extensions: 3364 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3355 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)