| Clone Name | bastl16b10 |
|---|---|
| Clone Library Name | barley_pub |
>ODP1_RALEU (Q59097) Pyruvate dehydrogenase E1 component (EC 1.2.4.1)| Length = 895 Score = 31.6 bits (70), Expect = 1.0 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 311 VRRINRSCSWAAARMRQISSMLQGLARSMSLGKERKEAEEGHGTVLRSS 457 ++RI C WAAA MR +L G A +L E + E+GH V ++ Sbjct: 611 IQRIGDLC-WAAADMRSRGFLLGGTAGRTTLNGEGLQHEDGHSHVFHAA 658
>MURB_MANSM (Q65WM5) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 341 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 310 RTQNQPILFLGGGENAADLVDAAG 381 R +NQP+LFLG G N L D AG Sbjct: 36 RQENQPVLFLGQGSNVLFLKDFAG 59
>CQ10B_XENLA (Q6GNP0) Protein COQ10 B, mitochondrial precursor| Length = 244 Score = 29.3 bits (64), Expect = 5.1 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 176 CCW--SGLSSIGMSCLCSLLARQRHQCRAPRN*GSKP 280 CCW SGLSS+ + LL ++ QCRA G KP Sbjct: 5 CCWGRSGLSSLTRA----LLEAEKRQCRALVRTGKKP 37
>SYV_SCHPO (O75005) Probable valyl-tRNA synthetase, mitochondrial precursor| (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 980 Score = 29.3 bits (64), Expect = 5.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 230 QEESRGRTCLWTTGRTSSTASLMSRSAFPPGSF 132 Q+ S GR W TGRT A +++AFP SF Sbjct: 538 QDRSEGR--YWVTGRTLEQAEEKAKAAFPGKSF 568
>ZAN_HUMAN (Q9Y493) Zonadhesin precursor| Length = 2812 Score = 28.9 bits (63), Expect = 6.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 438 PCPSSASFLSFPRDMERARPCS 373 PCP + S ++ PRD +A PC+ Sbjct: 1824 PCPDTCSSINNPRDCPKALPCA 1845
>HIS5_PICTO (Q6KZD3) Imidazole glycerol phosphate synthase subunit hisH (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) Length = 186 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 22 FLPLAILACYSFFFLGEVDPILSIYPVQARLFNPKQKKDPGGKADRDIKE 171 + PL C FF G ++I + A F+P++ +PG K R+ E Sbjct: 135 YAPLGSYTCGKTFFNGYFTSFININNIYAVQFHPEKSGEPGLKLLRNFGE 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,769,495 Number of Sequences: 219361 Number of extensions: 988279 Number of successful extensions: 3425 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3425 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)