| Clone Name | bastl16b02 |
|---|---|
| Clone Library Name | barley_pub |
>Y1836_MYCTU (Q50597) Hypothetical protein Rv1836c/MT1884| Length = 677 Score = 29.6 bits (65), Expect = 4.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 128 WKVDGGEGQTEVERGTAGADVNSSTLPTARSA 223 W DG EG+TEV G VN P A +A Sbjct: 530 WTFDGREGRTEVPAGPLADPVNGQPRPAALTA 561
>PTP99_DROME (P35832) Tyrosine-protein phosphatase 99A precursor (EC 3.1.3.48)| (Receptor-linked protein-tyrosine phosphatase 99A) (DPTP99A) Length = 1301 Score = 29.3 bits (64), Expect = 5.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -1 Query: 189 TSAPAVPLSTSVWPSPPSTFQLRSYHPS--PHRCAATTASRIS 67 +S+ P ++ P PP T QL S+ PS H+ ++T A+ S Sbjct: 1126 SSSTTPPTPSTPTPQPPQTIQLSSHSPSDLSHQISSTVANAAS 1168
>ACRO_RAT (P29293) Acrosin precursor (EC 3.4.21.10) [Contains: Acrosin light| chain; Acrosin heavy chain] Length = 437 Score = 29.3 bits (64), Expect = 5.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 189 TSAPAVPLSTSVWPSPPSTFQLRSYHPSPH 100 +SAP +PL + + P P +F L +YH H Sbjct: 352 SSAPVIPLLSLLTPVQPVSFTLAAYHTRHH 381
>AROK_AERPE (Q9YEK6) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 280 Score = 29.3 bits (64), Expect = 5.4 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -3 Query: 145 AAVDLPATELPSE---PSPMRRHDRLKDFDFFFFEATRISTGAAWV 17 A + +P E P E PSP RRH RL D A R+ W+ Sbjct: 171 AVIGVPGVENPVENLDPSPFRRHSRLYD------AAARLGLAGEWL 210
>K0552_HUMAN (O60299) Protein KIAA0552| Length = 673 Score = 28.9 bits (63), Expect = 7.1 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 2/95 (2%) Frame = +3 Query: 111 DGSSVAGRSTAARAKRRWRGGLQART*THRRCR-RQGLPLLTILRHPAWHRTRTVKNSEH 287 DG + AG + RA RR G LQA RR R RQG R + + ++ + Sbjct: 559 DGEAEAGGESGTRALRREVGRLQAELAAERRARERQGASFAEERRVWLEEKEKVIEYQKQ 618 Query: 288 ADPSN-QVSQALQKVEGEWSECARGASDTAGSSDP 389 S ++ Q Q++E E RGA+ A + P Sbjct: 619 LQLSYVEMYQRNQQLERRLRE--RGAAGGASTPTP 651
>HXD12_MOUSE (P23812) Homeobox protein Hox-D12 (Hox-4.7) (Hox-5.6)| Length = 279 Score = 28.9 bits (63), Expect = 7.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 208 DGKVCPCSPYSGTPRG 255 DGK CPCSP G P G Sbjct: 189 DGKQCPCSPKPGLPWG 204
>XRN1_SCHPO (P40383) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Exonuclease 2)| (Exonuclease II) (Exo II) (p140) Length = 1328 Score = 28.9 bits (63), Expect = 7.1 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = -1 Query: 225 RADLAVGSVDEFTSAPAVPLSTSVWPSPP-----STFQLRSYHPSP 103 + +++ +V + T + V TS +PSPP S + R +HP P Sbjct: 1216 KTNVSANNVSQGTDSRLVTKPTSTFPSPPSPPSSSVWNKREHHPKP 1261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,367,187 Number of Sequences: 219361 Number of extensions: 1351536 Number of successful extensions: 4416 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4415 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)