| Clone Name | bastl16b01 |
|---|---|
| Clone Library Name | barley_pub |
>YD14_SCHPO (Q10237) Hypothetical protein C4G9.04c in chromosome I| Length = 638 Score = 30.8 bits (68), Expect = 0.83 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 229 YKEALAELTFNCKPIITELTIIAGQH 306 Y AL +LTFN KPII LT IA ++ Sbjct: 8 YLSALEDLTFNSKPIIHTLTYIAQEN 33
>PCF11_YEAST (P39081) Protein PCF11 (protein 1 of CF I)| Length = 626 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 217 VVGVYKEALAELTFNCKPIITELTIIAGQH 306 +V + L ELTFN +PIIT LT +A ++ Sbjct: 8 IVKDFNSILEELTFNSRPIITTLTKLAEEN 37
>PCF11_HUMAN (O94913) Pre-mRNA cleavage complex 2 protein Pcf11 (Pre-mRNA| cleavage complex II protein Pcf11) (Fragment) Length = 1654 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +1 Query: 229 YKEALAELTFNCKPIITELTIIAGQH 306 Y+ +L +LTFN KP I LTI+A ++ Sbjct: 121 YQSSLEDLTFNSKPHINMLTILAEEN 146
>MASY_GOSHI (P17432) Malate synthase, glyoxysomal (EC 2.3.3.9)| Length = 567 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +1 Query: 142 VVGQVVERFRARLREEAGEEPKAAAVVGVYKEALAELTFNC 264 V G+VVE AR+ E G+E G+YKEA T C Sbjct: 501 VFGRVVEEEMARIEREVGKEKFKK---GMYKEACKIFTRQC 538
>EPOR_MOUSE (P14753) Erythropoietin receptor precursor (EPO-R)| Length = 507 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 16 PAWPCFASACLLLVASLPNPSPRRPFPE 99 P WP CLLL + PSP P P+ Sbjct: 7 PLWPRVGPLCLLLAGAAWAPSPSLPDPK 34
>GAG_JSRV (P31622) Gag polyprotein [Contains: Core protein p10; Core protein| p18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 612 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +1 Query: 1 NPNTFPAWPCFASACLLLVASLPNPSPRRPFPETLDLPMXXXXXXXPVVGQVVERF 168 N NTFP+ P F A V + +P P P P P+ +G+VV F Sbjct: 197 NNNTFPSAPPFPPAYTPTVMAGLDPPPGFPPPSKHMSPLQKALRQAQRLGEVVSDF 252 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,448,252 Number of Sequences: 219361 Number of extensions: 368545 Number of successful extensions: 1043 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)