| Clone Name | bastl15h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LONH2_MAIZE (P93648) Lon protease homolog 2, mitochondrial precu... | 48 | 7e-06 | 2 | YM44_CAEEL (P34520) Hypothetical protein K11H3.4 | 30 | 2.1 | 3 | RT03_PETHY (Q04716) Mitochondrial ribosomal protein S3 | 29 | 3.5 | 4 | RPGR1_BOVIN (Q9GLM3) X-linked retinitis pigmentosa GTPase regula... | 29 | 3.5 | 5 | SETBP_MOUSE (Q9Z180) SET-binding protein (SEB) | 28 | 6.0 |
|---|
>LONH2_MAIZE (P93648) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 964 Score = 47.8 bits (112), Expect = 7e-06 Identities = 24/34 (70%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +2 Query: 191 EEMRSPLLRVFGSLRGGRSSV-MGRRARFCSSFS 289 EE+RSPLLRV G+LR GR SV +GRR RFCS+ S Sbjct: 10 EELRSPLLRVIGTLRDGRGSVLLGRRVRFCSNSS 43
>YM44_CAEEL (P34520) Hypothetical protein K11H3.4| Length = 717 Score = 29.6 bits (65), Expect = 2.1 Identities = 10/23 (43%), Positives = 19/23 (82%) Frame = -3 Query: 75 DEQPRMCGRRALPFWFGEEERKE 7 DE+ G+R+LPF++G+E++K+ Sbjct: 572 DEKRLTVGKRSLPFYYGDEDKKK 594
>RT03_PETHY (Q04716) Mitochondrial ribosomal protein S3| Length = 562 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 4 SFLSFFFPKPERQSTPPAHPRLLVQTLESHRPTV 105 + FFFPK R P +H LL +TL + RP++ Sbjct: 203 NLFKFFFPKKSRSDRPTSH--LLKRTLPAVRPSL 234
>RPGR1_BOVIN (Q9GLM3) X-linked retinitis pigmentosa GTPase regulator-interacting| protein 1 (RPGR-interacting protein 1) Length = 1221 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 10 LSFFFPKPERQSTPPAHPRLLVQTLE 87 +S F P+RQS P HP L +T++ Sbjct: 410 ISTFSQSPDRQSAPATHPALFQETIQ 435
>SETBP_MOUSE (Q9Z180) SET-binding protein (SEB)| Length = 1535 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 276 QKRARLPITELRPPLSDPKT 217 +KR R P TEL PP +PKT Sbjct: 669 KKRGRKPRTELPPPSEEPKT 688 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,059,379 Number of Sequences: 219361 Number of extensions: 350546 Number of successful extensions: 1342 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1340 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)