| Clone Name | bastl15e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 51 | 6e-07 | 2 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 51 | 6e-07 | 3 | NUPL_XENLA (P05221) Nucleoplasmin | 31 | 0.83 | 4 | FOXK2_HUMAN (Q01167) Forkhead box protein K2 (Interleukin enhanc... | 29 | 3.2 | 5 | PEX6_GLOLA (Q9C1E9) Peroxisomal biogenesis factor 6 (Peroxin-6) ... | 28 | 5.4 | 6 | HR1A_TRIFL (Q8JIR2) Hemorrhagic metalloproteinase HR1a precursor... | 27 | 9.2 |
|---|
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 51.2 bits (121), Expect = 6e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 292 MLPRKREIVAGEVEDLQKITRAGEGE 369 MLPRKREIVAGEVEDLQK TRAGEGE Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGE 26
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 51.2 bits (121), Expect = 6e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 292 MLPRKREIVAGEVEDLQKITRAGEGE 369 MLPRKREIVAGEVEDLQK TRAGEGE Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGE 26
>NUPL_XENLA (P05221) Nucleoplasmin| Length = 200 Score = 30.8 bits (68), Expect = 0.83 Identities = 19/77 (24%), Positives = 30/77 (38%) Frame = -3 Query: 276 AEEPEDGRRRSEEQAVVDGRRELPRQIQRVRPPRNLHRPGTSXXXXXXXXXXXGRADPAE 97 A E + E++ +G E + + PP+ + RP + + D + Sbjct: 119 AMEEDYSWAEEEDEGEAEGEEEEEEEEDQESPPKAVKRPAATKKAGQAKKKKLDKEDESS 178 Query: 96 LTLDSPVASGKEAGEGR 46 DSP GK AG GR Sbjct: 179 EE-DSPTKKGKGAGRGR 194
>FOXK2_HUMAN (Q01167) Forkhead box protein K2 (Interleukin enhancer-binding| factor 1) (Cellular transcription factor ILF-1) Length = 655 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 276 AEEPEDGRRRSEEQAVVDGRRELPRQIQRVRPPRNLHRPG 157 ++E G R + A + GR P ++ PPR+LH PG Sbjct: 43 SDEEALGDHRPQLVAGLGGREHGPLELHLPAPPRDLHAPG 82
>PEX6_GLOLA (Q9C1E9) Peroxisomal biogenesis factor 6 (Peroxin-6) (ClaPEX6)| Length = 1388 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 78 VASGKEAGEGRSV*GFWDGTGGPD 7 V +GK G+G++V GF DGT D Sbjct: 1361 VVNGKGKGKGKAVAGFQDGTASDD 1384
>HR1A_TRIFL (Q8JIR2) Hemorrhagic metalloproteinase HR1a precursor (EC 3.4.24.-)| [Contains: Disintegrin-like 1a] Length = 609 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 224 TAAGSCRVRSSACDRRETCT 165 TA CR R S CD E+CT Sbjct: 457 TAGTECRARRSECDIAESCT 476 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,761,383 Number of Sequences: 219361 Number of extensions: 553968 Number of successful extensions: 1922 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1919 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)