| Clone Name | bastl15b03 |
|---|---|
| Clone Library Name | barley_pub |
>KI13B_HUMAN (Q9NQT8) Kinesin-like protein KIF13B (Kinesin-like protein GAKIN)| Length = 1826 Score = 32.7 bits (73), Expect = 0.21 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 33 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRP 125 PPT P +PPG Q+ SP L +P P Sbjct: 1612 PPTAVPAEEPPGPQQLVSPGRERPDLEAPAP 1642
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 32.3 bits (72), Expect = 0.28 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +3 Query: 36 PTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI---PPH 161 P APT+ PP R SP H R + P P + P + PPH Sbjct: 51 PPSAPTTTPPSRGHVPSPRHAPPRHAYPPPSHGHLPPSVGGPPPH 95
>CD248_HUMAN (Q9HCU0) Endosialin precursor (Tumor endothelial marker 1) (CD248| antigen) Length = 757 Score = 31.6 bits (70), Expect = 0.48 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = +3 Query: 33 PPTHAP----TSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PNQWLLGLQRS 200 PP H P T P SP +R++ + THL P IPP+ P LG Q Sbjct: 509 PPAHQPPMISTKYPELFPAHQSPMFPDTRVAGTQTTTHL--PGIPPNHAPLVTTLGAQLP 566 Query: 201 PQA 209 PQA Sbjct: 567 PQA 569
>BAGS_BOMMO (Q9BLJ6) BAG domain-containing protein Samui| Length = 677 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 33 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLIT 143 PP +P QPP ++ T P +T + SS P T +++ Sbjct: 350 PPPKSPQQQPPPQREQTPPQPKTQQPSSNDPITQILS 386
>KAR9_YEAST (P32526) Karyogamy protein KAR9 (Cortical protein KAR9)| Length = 644 Score = 31.2 bits (69), Expect = 0.63 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 33 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPR 149 PPT T P Q W + R +RL P P + L++PR Sbjct: 599 PPTKITT---PNSQVWVPSTRRRTRLRPPTPLSQLLSPR 634
>EXTN_SORBI (P24152) Extensin precursor (Proline-rich glycoprotein)| Length = 283 Score = 30.8 bits (68), Expect = 0.82 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 18 PTRIHPPTHAPTSQPPGRQRWTS-PSHRTSRLSSPRPCTHLITPRIPP 158 P + PPT+ PT +PP + TS P+H P+P H P+ P Sbjct: 204 PPKPSPPTYTPTPKPPATKPPTSTPTH-------PKPTPHTPYPQAHP 244 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +3 Query: 18 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIP 155 P PPT+ P+ +PP + T P+ + P P + +P+ P Sbjct: 109 PKASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPVYTPSPKPP 154 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +3 Query: 18 PTRIHPPTHAPTSQPPGRQRWTSPSHRTS-RLSSPRPCTHLITPRIP 155 P PPTH P+ +PP + T P + S + P P T+ TP+ P Sbjct: 174 PPVTKPPTHTPSPKPP-TSKPTPPVYTPSPKPPKPSPPTYTPTPKPP 219
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 24 RIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPP 158 R H P+ + + P RQ+ TSP R R SP P +P P Sbjct: 521 RRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAP 565 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 12 RFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPR----PCTHLITPRIPP 158 R P+ PP T PP R+R SP R R SPR P +P PP Sbjct: 559 RSPSPAPPPRRRRTPTPPPRRRTPSPPPR-RRSPSPRRYSPPIQRRYSPSPPP 610
>SFRS2_RAT (Q6PDU1) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 19 PPESIHLRTRPPPSRLGGSDGRRR 90 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>SFRS2_PANTR (Q5R1W5) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 19 PPESIHLRTRPPPSRLGGSDGRRR 90 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>SFRS2_MOUSE (Q62093) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) (Putative myelin regulatory factor 1) (MRF-1) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 19 PPESIHLRTRPPPSRLGGSDGRRR 90 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>SFRS2_HUMAN (Q01130) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 19 PPESIHLRTRPPPSRLGGSDGRRR 90 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>PDXH_RHILO (Q986A0) Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP| oxidase) (PNPOx) Length = 205 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -2 Query: 298 RRSIWAAKKSRSTEGAG*SAEARSETDSAHACGERCRPRSHWLG 167 R WA+K+SR E +A +E + +A GE RP+ HW G Sbjct: 124 RIGAWASKQSRPLESRFALEKAVAEYTARYAIGEIPRPK-HWSG 166
>SFRS2_CHICK (P30352) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 221 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 19 PPESIHLRTRPPPSRLGGSDGRRR 90 PP+S H R PPP R G S RR Sbjct: 95 PPDSHHSRRGPPPRRYGSSGYGRR 118
>SGS3_DROME (P02840) Salivary glue protein Sgs-3 precursor| Length = 307 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 18 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPC 128 PT P T PT+ P + T+ T++ ++P+PC Sbjct: 223 PTTTKPTTTKPTTTKPTTTKPTTTKPTTTKPTTPKPC 259
>SPTA3_MOUSE (Q9D9T6) Spermatogenesis-associated protein 3 (Testis spermatocyte| apoptosis-related protein 1) (Testis and spermatogenesis cell-related protein 1) (mTSARG1) Length = 193 Score = 28.5 bits (62), Expect = 4.1 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +3 Query: 6 SSRFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITP-RIPPHV*PNQ 176 S R I P T + +SQ P + S S S P+PC TP ++ P P Q Sbjct: 11 SRRRRNSISPQTSSDSSQQPSSETPPSCPEPASPPSKPQPCQESTTPHQVNPEPKPQQ 68
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 12 RFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPR----PCTHLITPRIPP 158 R P+ PP T PP R+R SP R R SPR P +P PP Sbjct: 573 RSPSPAPPPRRRRTPTPPPRRRTPSPPPR-RRSPSPRRYSPPIQRRYSPSPPP 624
>GCYA2_HUMAN (P33402) Guanylate cyclase soluble subunit alpha-2 (EC 4.6.1.2)| (GCS-alpha-2) Length = 732 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -3 Query: 228 ARQTAPTPAASAVGRGATGWARRAE 154 A APTPAASA AT ARR + Sbjct: 56 AAAPAPTPAASAAAAAATAGARRVQ 80
>PACC_ASPPA (Q96UW0) pH-response transcription factor pacC/RIM101| Length = 662 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 6 SSRFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI-PPH 161 +S P +P TH+PT P T PS S S P + T R+ PPH Sbjct: 394 TSAGPMMANPATHSPTGTP----ALTPPSSAQSYTSGRSPISLPSTSRVSPPH 442
>PACC_ASPOR (Q9HFB3) pH-response transcription factor pacC/RIM101| Length = 662 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 6 SSRFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI-PPH 161 +S P +P TH+PT P T PS S S P + T R+ PPH Sbjct: 394 TSAGPIMANPATHSPTGTP----ALTPPSSAQSYTSGRSPISLPSTSRVSPPH 442
>DACH1_MOUSE (Q9QYB2) Dachshund homolog 1 (Dach1)| Length = 751 Score = 28.1 bits (61), Expect = 5.3 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 36 PTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPH---V*PNQWLLGL 191 P+ AP+ + R SHR+S +SS T + RIP H + NQ L+GL Sbjct: 485 PSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGL 539
>SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein| Length = 977 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = +3 Query: 3 ISSRFPTRIHP-----PTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITP 146 +SS+ PT + P+HAP S P R + P TS L P P + +TP Sbjct: 510 LSSQGPTPLPSFTSGVPSHAPVSGSPSTPRSSGPVTATSSLYIPAP-SRPVTP 561
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 9/49 (18%) Frame = +3 Query: 3 ISSRFPTRIHPPTHAPT--SQPPGRQ-------RWTSPSHRTSRLSSPR 122 +S R HP + +PT SQ P R+ R SP+ R R SSPR Sbjct: 71 LSPRDQPHSHPRSRSPTPRSQSPSRRSVRSPSPRQGSPARRVDRSSSPR 119 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 9 SRFPTRIHPPTHAPTSQPP---GRQRWTSPSHRTSRLSSPRP 125 SR P+R T +P + PP GR S S SR SP P Sbjct: 814 SRSPSRSRSRTRSPAAAPPIRRGRSGTRSRSRSYSRSPSPPP 855
>SWR1_GIBZE (Q4IAK7) Helicase SWR1 (EC 3.6.1.-)| Length = 1691 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 22/59 (37%) Frame = +3 Query: 30 HPPTHAPTSQPPGRQRWTSP----------------------SHRTSRLSSPRPCTHLI 140 H P P + PP R TSP H TSR SP+P H I Sbjct: 743 HSPATEPATNPPSRVHSTSPPATSETKPSELDTASTEEMAVDKHDTSRSPSPQPSNHKI 801
>DACH1_HUMAN (Q9UI36) Dachshund homolog 1 (Dach1)| Length = 758 Score = 28.1 bits (61), Expect = 5.3 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 36 PTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPH---V*PNQWLLGL 191 P+ AP+ + R SHR+S +SS T + RIP H + NQ L+GL Sbjct: 492 PSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGL 546
>TBX15_MOUSE (O70306) T-box transcription factor TBX15 (T-box protein 15)| (MmTBx8) Length = 602 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 66 GRQRWTSPSHRTSRLSSPRPCTHLITPRIPP---HV*PNQWLLGLQRS 200 G TSP+ ++ SP +HL++P P H+ PN + +G + S Sbjct: 342 GGSTGTSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRES 389
>TBX15_HUMAN (Q96SF7) T-box transcription factor TBX15 (T-box protein 15)| Length = 602 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 66 GRQRWTSPSHRTSRLSSPRPCTHLITPRIPP---HV*PNQWLLGLQRS 200 G TSP+ ++ SP +HL++P P H+ PN + +G + S Sbjct: 342 GGSTGTSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRES 389
>REEP2_MOUSE (Q8VCD6) Receptor expression-enhancing protein 2| Length = 254 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 1 KSPLASPPESIHLRTRPPPSRLGGSD 78 K P A PP S L+TRP GG D Sbjct: 227 KVPRAEPPASKTLKTRPKKKSSGGGD 252
>EXTN_MAIZE (P14918) Extensin precursor (Proline-rich glycoprotein)| Length = 267 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 33 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PN 173 PPT+ P+ +PP + T P++ SP+P TH PP P+ Sbjct: 145 PPTYTPSPKPP-TPKPTPPTY----TPSPKPPTHPTPKPTPPTYTPS 186
>CX038_HUMAN (Q8TB03) Protein CXorf38| Length = 319 Score = 27.7 bits (60), Expect = 6.9 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = -2 Query: 202 GERCRPRSHWLG*TCGGMRGVIKCVHGRGE-LSLDVR*LGDVH--RCRPGGWEVGA 44 G RC PR+ C C + E L V GDVH CRPG W V A Sbjct: 63 GSRCSPRARQFQPQCQ------VCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDA 112
>WBP11_BRARE (Q6P0D5) WW domain-binding protein 11 (WBP-11)| Length = 640 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +3 Query: 33 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPP 158 PP+ P PPG + P S L P P L+ P PP Sbjct: 391 PPSGPPPGPPPGAPPFLRPPGLPSALRGPMP--RLLPPGPPP 430
>RL32_SYMTH (Q67PG5) 50S ribosomal protein L32| Length = 64 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +3 Query: 69 RQRWTSPSHRTSRLSSPR--PCTHLITPRIPPHV*PN 173 + R S +T RL +P PC + TPR+P V PN Sbjct: 10 KSRRDSRRAQTFRLEAPNLSPCPNCRTPRLPHRVCPN 46
>CGLH_XANMA (P37126) Chorionicgonadotropic hormone-like protein (CG-like| protein) Length = 443 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 18 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLIT 143 P ++P APT+ P G + S + RT R C H ++ Sbjct: 133 PRGVNPVPSAPTAPPAGLAAFPSANRRTERCLVWIACVHRLS 174
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 27.3 bits (59), Expect = 9.0 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +3 Query: 9 SRFPTRIHPPTHAPTSQPPGRQRWTSPSHRT-----SRLSSPRPCTHLITP 146 SR PT PP +Q GRQR +PS R+ SR SPR ++ +P Sbjct: 744 SRSPT---PPRRQAPAQQRGRQRSYTPSDRSRSRSYSRSRSPRGRSYTRSP 791
>MYC_ONCMY (P06646) Myc protein (c-myc) (Fragment)| Length = 414 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 92 SPDIQAQLAAAVHALNHASHPSARLAQPVAPR 187 SP + + + H N+A+HPS R QP R Sbjct: 261 SPLVLKRCHVSTHQHNYAAHPSTRHEQPAVKR 292
>CT111_MOUSE (Q9D722) Protein C20orf111 homolog| Length = 291 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 1 KSPLASPPESIHLRTRPPPS 60 KSP+ PP+ IH T PPS Sbjct: 83 KSPVLHPPKFIHCSTTAPPS 102
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 51 TSQPP-GRQRWTSPSHRTSRLSSPRPCTHLITPRIPP 158 T PP +R SH T+ S PRP LI+ PP Sbjct: 509 TMDPPVSEERSVQQSHPTTTTSPPRPYPELISRPSPP 545 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,792,344 Number of Sequences: 219361 Number of extensions: 750800 Number of successful extensions: 2852 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 2524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2818 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)