| Clone Name | bastl14h12 |
|---|---|
| Clone Library Name | barley_pub |
>SREC2_HUMAN (Q96GP6) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) (SRECRP-1) Length = 866 Score = 30.8 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 10/39 (25%) Frame = -1 Query: 91 RARPPRPDP---------HG-HGAAWSGRTPWHPDPGTK 5 R +PP PDP HG H AA +GR P P PG++ Sbjct: 651 RRKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSE 689
>SPT5H_CHICK (Q5ZI08) Transcription elongation factor SPT5 (DRB| sensitivity-inducing factor large subunit) (DSIF large subunit) Length = 1079 Score = 30.4 bits (67), Expect = 1.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 79 PRPDPHGHGAAWSGRTPWHPDPGTKQ 2 P P P G+G + +TP +PDP + Q Sbjct: 836 PTPSPQGYGGTPNPQTPGYPDPSSPQ 861
>PDCD7_HUMAN (Q8N8D1) Programmed cell death protein 7 (ES18) (HES18)| Length = 485 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 79 PRPDPHGHGAAWSGRTPWHPDP 14 PRP P G G WS R P P P Sbjct: 107 PRPPPPGPGPPWSPRWPEAPPP 128
>GLUQ_NEIMA (Q9JST9) Glutamyl-Q tRNA(Asp) synthetase (EC 6.1.1.-) (Glu-Q-RSs)| Length = 295 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 7/40 (17%) Frame = -1 Query: 127 EWRRPAAR-------SGRCRARPPRPDPHGHGAAWSGRTP 29 +W+ A R +GRCR RP P G AW R P Sbjct: 103 DWQTGARRGADGFVYNGRCRNPQQRPAPQGKQPAWRIRVP 142
>SPT5H_HUMAN (O00267) Transcription elongation factor SPT5 (hSPT5) (DRB| sensitivity-inducing factor large subunit) (DSIF large subunit) (DSIF p160) (Tat-cotransactivator 1 protein) (Tat-CT1 protein) Length = 1087 Score = 28.1 bits (61), Expect = 6.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 79 PRPDPHGHGAAWSGRTPWHPDPGTKQ 2 P P P +G + +TP +PDP + Q Sbjct: 844 PTPSPQAYGGTPNPQTPGYPDPSSPQ 869
>SPT5H_PONPY (Q5R405) Transcription elongation factor SPT5 (DRB| sensitivity-inducing factor large subunit) (DSIF large subunit) Length = 1083 Score = 28.1 bits (61), Expect = 6.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 79 PRPDPHGHGAAWSGRTPWHPDPGTKQ 2 P P P +G + +TP +PDP + Q Sbjct: 840 PTPSPQAYGGTPNPQTPGYPDPSSPQ 865
>SPT5H_MOUSE (O55201) Transcription elongation factor SPT5 (DRB| sensitivity-inducing factor large subunit) (DSIF large subunit) Length = 1082 Score = 28.1 bits (61), Expect = 6.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 79 PRPDPHGHGAAWSGRTPWHPDPGTKQ 2 P P P +G + +TP +PDP + Q Sbjct: 838 PTPSPQAYGGTPNPQTPGYPDPSSPQ 863
>SPP2_ASHGO (Q753C4) Pre-mRNA-splicing factor SPP2| Length = 207 Score = 27.7 bits (60), Expect = 9.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 96 AAERDRRVLIPTATGQLGVAAPHGTQTQAPS 4 AA+ RRV++P +G+ + P Q PS Sbjct: 50 AAKAKRRVIVPACSGRASIVPPKFASEQGPS 80
>FBX46_HUMAN (Q6PJ61) F-box only protein 46 (F-box only protein 34-like)| Length = 646 Score = 27.7 bits (60), Expect = 9.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -1 Query: 130 DEWRRPAARSGRCRARPPRPDPHGHGAAWSGRTP 29 +E R R G RPP P P G + GR P Sbjct: 600 EEGRSTRGRGGESPPRPPLPSPPGSRGSGLGRLP 633 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,474,310 Number of Sequences: 219361 Number of extensions: 358239 Number of successful extensions: 1793 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1791 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)