| Clone Name | bastl14g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BMS1_SCHPO (O94653) Ribosome biogenesis protein BMS1 homolog | 43 | 2e-04 | 2 | BMS1_YEAST (Q08965) Ribosome biogenesis protein BMS1 | 39 | 0.004 | 3 | BMS1_HUMAN (Q14692) Ribosome biogenesis protein BMS1 homolog | 38 | 0.005 | 4 | ATRX_MOUSE (Q61687) Transcriptional regulator ATRX (EC 3.6.1.-) ... | 29 | 3.3 | 5 | NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protei... | 28 | 5.6 | 6 | PRIM_PSEAE (Q9I5W0) DNA primase (EC 2.7.7.-) | 28 | 5.6 |
|---|
>BMS1_SCHPO (O94653) Ribosome biogenesis protein BMS1 homolog| Length = 1121 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = +2 Query: 236 NPKAFAFRSATKAKRLQSRSAEIEQRRLHVPIMDRSIGE 352 NPKAFA SA + R R+A+I Q++LHVP++DR+ E Sbjct: 32 NPKAFAVASAGRMARQAMRTADISQKKLHVPMVDRTPDE 70
>BMS1_YEAST (Q08965) Ribosome biogenesis protein BMS1| Length = 1183 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +2 Query: 236 NPKAFAFRSATKAKRLQSRSAEIEQRRLHVPIMDRS 343 N KAFA + K R RS+++ +R+LHVP++DR+ Sbjct: 27 NAKAFAVAAPGKMARTMQRSSDVNERKLHVPMVDRT 62
>BMS1_HUMAN (Q14692) Ribosome biogenesis protein BMS1 homolog| Length = 1282 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/38 (36%), Positives = 28/38 (73%) Frame = +2 Query: 230 RKNPKAFAFRSATKAKRLQSRSAEIEQRRLHVPIMDRS 343 ++NPKAFA +SA + R R+ +++ ++ H+P++DR+ Sbjct: 39 KRNPKAFAVQSAVRMARSFHRTQDLKTKKHHIPVVDRT 76
>ATRX_MOUSE (Q61687) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked nuclear protein) (Heterochromatin protein 2) (HP1 alpha-interacting protein) (HP1-BP38 protein) Length = 2476 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +2 Query: 68 QKPR-EHRLRKTLLTMAPGEAGVEQPRK 148 +KPR HRL + LT++ GE+G E+P K Sbjct: 1319 KKPRYRHRLLRHKLTLSDGESGEEKPTK 1346
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 247 FCLPFSNKSEA-ATISISGN*TTPSPCANHGSLNW 348 +C F+NK++ T+ + N T+PS C G NW Sbjct: 302 WCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNW 336
>PRIM_PSEAE (Q9I5W0) DNA primase (EC 2.7.7.-)| Length = 664 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -3 Query: 127 GFPRSHGEEGFAEAVLAGFLRRRRGMAAGKEESGGRG 17 GF H + F +AV L +R GM +EE GGRG Sbjct: 72 GFVMDHDQLEFPQAVEE--LAKRAGMDVPREERGGRG 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,772,879 Number of Sequences: 219361 Number of extensions: 378709 Number of successful extensions: 1178 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1178 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)