| Clone Name | bastl14f09 |
|---|---|
| Clone Library Name | barley_pub |
>YBLE_SCHPO (Q10342) Hypothetical protein C106.14c in chromosome II| Length = 719 Score = 32.3 bits (72), Expect = 0.31 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +3 Query: 162 HSLPALQAKMKRDPEGYETELRQLQRHFESS--VFLFRQQSALS 287 ++LP LQ +K+DP+ Y E Q H+E++ +FL S +S Sbjct: 12 NNLPHLQHLVKKDPKSYREEFLQQWNHYETAREIFLVNPSSDIS 55
>YG58_YEAST (P53313) Hypothetical 86.6 kDa protein in PFK1-TDS4 intergenic| region Length = 767 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 177 LQAKMKRDPEGYETELRQLQRHFES 251 LQ +KRDPE Y+ E Q H+ES Sbjct: 17 LQNLVKRDPESYQEEFLQQYAHYES 41
>DGCR6_HUMAN (Q14129) DGCR6 protein (DiGeorge syndrome critical region 6)| Length = 220 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 162 HSLPALQAKMKRDPEGYETELRQLQRHFESSVFL 263 H+LP LQA +R+ E E +R+ QR + + L Sbjct: 110 HNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVL 143
>YZR3_ARATH (Q8GZ43) RanBP2-type zinc-finger protein At1g67325| Length = 288 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 295 EDGDSADCCRKRNTEDSKWRCSWRSSVSYPSGSR 194 + G S+D K+N + W+C +++YP S+ Sbjct: 227 QQGGSSDKISKQNAPEGSWKCDNCGNINYPFRSK 260
>DGCR6_MOUSE (O35347) DGCR6 protein (DiGeorge syndrome critical region 6| homolog) Length = 198 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 162 HSLPALQAKMKRDPEGYETELRQLQRHFESSVFL 263 H+LP LQA +R+ E E +R+ Q+ + + L Sbjct: 110 HNLPVLQAAQQRELEAMEHRIREEQQAMDRKIVL 143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,411,227 Number of Sequences: 219361 Number of extensions: 318002 Number of successful extensions: 922 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)