| Clone Name | bastl14f02 |
|---|---|
| Clone Library Name | barley_pub |
>YDFC_SCHPO (Q10484) Hypothetical protein C17C9.12 in chromosome I| Length = 319 Score = 28.5 bits (62), Expect = 4.2 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = +3 Query: 27 PSTLTLNHTETPSPLLVPRTRPTNCPSFAHTLPIMS*SVRLPRLYIYPHVIVVATS 194 PST T HT+ P V +P PS A P + + P Y P + TS Sbjct: 184 PSTATTQHTQLPKTSAVSHQKPHEAPSTAVKAPTATVAENEP--YPKPQSVPTTTS 237
>CAND1_RAT (P97536) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) (TBP-interacting protein TIP120A) (TBP-interacting protein of 120 kDa A) Length = 1230 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 9 LLLNFHPSTLTLNHTETPSPLLVPRTR 89 LL+NFHPS LT + SP L R R Sbjct: 168 LLVNFHPSILTCLLPQLTSPRLAVRKR 194
>CAND1_PONPY (Q5R6L5) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) Length = 1230 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 9 LLLNFHPSTLTLNHTETPSPLLVPRTR 89 LL+NFHPS LT + SP L R R Sbjct: 168 LLVNFHPSILTCLLPQLTSPRLAVRKR 194
>CAND1_MOUSE (Q6ZQ38) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) Length = 1230 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 9 LLLNFHPSTLTLNHTETPSPLLVPRTR 89 LL+NFHPS LT + SP L R R Sbjct: 168 LLVNFHPSILTCLLPQLTSPRLAVRKR 194
>CAND1_HUMAN (Q86VP6) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) (TBP-interacting protein TIP120A) (TBP-interacting protein of 120 kDa A) Length = 1230 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 9 LLLNFHPSTLTLNHTETPSPLLVPRTR 89 LL+NFHPS LT + SP L R R Sbjct: 168 LLVNFHPSILTCLLPQLTSPRLAVRKR 194
>YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region| Length = 153 Score = 27.7 bits (60), Expect = 7.2 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 9/55 (16%) Frame = +3 Query: 24 HPSTLTLNHTETPSP-------LLVPRTRPTNCPSFAHT--LPIMS*SVRLPRLY 161 HP T T H TP+P P T PT P HT + + S+ LP Y Sbjct: 29 HPHTPTHTHPHTPTPTPHPHPHTPHPHTTPTPTPHHTHTPHTTLSNLSLNLPSHY 83
>DOT6_YEAST (P40059) Disrupter of telomere silencing protein 6| Length = 670 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 14 P*FPSIHTY-P*PHRNSISSSCTTHQTNQLSIFCPHS 121 P FP+ +T+ PH +S+SSS T H++ + S F HS Sbjct: 393 PIFPNSYTFMDLPHSSSVSSSSTLHKSKRGS-FSGHS 428
>CAR2_DICDI (P34907) Cyclic AMP receptor 2 (cAMP receptor 2)| Length = 375 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 83 HQTNQLSIFCPHSSNHVLISKATTLIYIPTRNCSGY 190 H T +S+FC S +IS TL+Y P + SG+ Sbjct: 41 HITKIISLFCATSLFKDVISTIITLLYKPDQTESGF 76
>NDVB_RHIME (P20471) Protein ndvB| Length = 2832 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 45 NHTETPSPLLVPRTRPTN 98 N ETP P+L RT PTN Sbjct: 1025 NFQETPQPVLAERTSPTN 1042
>CHSTD_HUMAN (Q8NET6) Carbohydrate sulfotransferase 13 (EC 2.8.2.5) (Chondroitin| 4-O-sulfotransferase 3) (Chondroitin 4-sulfotransferase 3) (C4ST3) (C4ST-3) Length = 341 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 53 RNSISSSCTTHQTNQLSIFCPHSSNHVLISKATTLI--YIPTRNCSGYE 193 R+ ++S+C+ H Q + P HVL+ A L+ Y+P C+ ++ Sbjct: 74 RDLLNSACSRHSRRQ-RLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWK 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,399,967 Number of Sequences: 219361 Number of extensions: 958470 Number of successful extensions: 3052 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3046 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)