| Clone Name | bastl14d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BMS1_SCHPO (O94653) Ribosome biogenesis protein BMS1 homolog | 44 | 1e-04 | 2 | BMS1_HUMAN (Q14692) Ribosome biogenesis protein BMS1 homolog | 38 | 0.007 | 3 | BMS1_YEAST (Q08965) Ribosome biogenesis protein BMS1 | 37 | 0.009 | 4 | ATRX_MOUSE (Q61687) Transcriptional regulator ATRX (EC 3.6.1.-) ... | 28 | 4.1 | 5 | PRIM_PSEAE (Q9I5W0) DNA primase (EC 2.7.7.-) | 28 | 5.4 | 6 | KCNB2_RAT (Q63099) Potassium voltage-gated channel subfamily B m... | 28 | 7.0 |
|---|
>BMS1_SCHPO (O94653) Ribosome biogenesis protein BMS1 homolog| Length = 1121 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = +2 Query: 272 NPKAFAFRSATRAKRLQSRSAEIEQRRLHVPIMDRS 379 NPKAFA SA R R R+A+I Q++LHVP++DR+ Sbjct: 32 NPKAFAVASAGRMARQAMRTADISQKKLHVPMVDRT 67
>BMS1_HUMAN (Q14692) Ribosome biogenesis protein BMS1 homolog| Length = 1282 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/36 (41%), Positives = 26/36 (72%) Frame = +2 Query: 272 NPKAFAFRSATRAKRLQSRSAEIEQRRLHVPIMDRS 379 NPKAFA +SA R R R+ +++ ++ H+P++DR+ Sbjct: 41 NPKAFAVQSAVRMARSFHRTQDLKTKKHHIPVVDRT 76
>BMS1_YEAST (Q08965) Ribosome biogenesis protein BMS1| Length = 1183 Score = 37.4 bits (85), Expect = 0.009 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +2 Query: 272 NPKAFAFRSATRAKRLQSRSAEIEQRRLHVPIMDRS 379 N KAFA + + R RS+++ +R+LHVP++DR+ Sbjct: 27 NAKAFAVAAPGKMARTMQRSSDVNERKLHVPMVDRT 62
>ATRX_MOUSE (Q61687) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked nuclear protein) (Heterochromatin protein 2) (HP1 alpha-interacting protein) (HP1-BP38 protein) Length = 2476 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 107 KPR-EHRLRKTLLTMAPGEAGVEQPRK 184 KPR HRL + LT++ GE+G E+P K Sbjct: 1320 KPRYRHRLLRHKLTLSDGESGEEKPTK 1346
>PRIM_PSEAE (Q9I5W0) DNA primase (EC 2.7.7.-)| Length = 664 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 163 GFPRSHGEEGFAEAVLAGFLRRRRGMAAGKEESGGRG 53 GF H + F +AV L +R GM +EE GGRG Sbjct: 72 GFVMDHDQLEFPQAVEE--LAKRAGMDVPREERGGRG 106
>KCNB2_RAT (Q63099) Potassium voltage-gated channel subfamily B member 2| (Voltage-gated potassium channel subunit Kv2.2) (CDRK) Length = 907 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +3 Query: 285 LPSVQQQERSGYNLDQRKLSNAVSMCQSW 371 LP +Q+ + G D RKL++ ++C +W Sbjct: 215 LPELQENDEFGQPSDNRKLAHVEAVCIAW 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,936,045 Number of Sequences: 219361 Number of extensions: 414837 Number of successful extensions: 1271 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1271 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)