| Clone Name | bastl13h09 |
|---|---|
| Clone Library Name | barley_pub |
>SC24C_ARATH (Q9M291) Protein transport protein Sec24-like CEF| Length = 1097 Score = 33.1 bits (74), Expect = 0.30 Identities = 22/65 (33%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = +3 Query: 42 GEVTKAAPPREARSVGALPSAPQLRH-PMRARLPLFIQRHAAAKGVAGSPVSSPVAHRVS 218 G PP GA P Q PM A P + Q A SP+SSP AH + Sbjct: 218 GGTLSNGPPPPMMGPGAFPRGSQFTSGPMMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIP 277 Query: 219 SPLCF 233 +P F Sbjct: 278 APTNF 282
>WASF4_HUMAN (Q8IV90) Wiskott-Aldrich syndrome protein family member 4| (WASP-family protein member 4) Length = 625 Score = 32.3 bits (72), Expect = 0.51 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 209 SRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 S ++S P P L +P S+P P PPPPP Sbjct: 420 SSVVSPSHPPPAPPLGSPPSSKPGFAPPPAPPPPPP 455 Score = 29.3 bits (64), Expect = 4.3 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVD----APYSPPPPP 316 PPP PTL P L AP PPPPP Sbjct: 497 PPPAADYPTLPPPPLSQPTRGAPPPPPPPP 526 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP L+ PT P P PPPPP Sbjct: 507 PPPPLSQPTRGAP-----PPPPPPPP 527
>MAZ_MOUSE (P56671) Myc-associated zinc finger protein (MAZI) (Purine-binding| transcription factor) (Pur-1) Length = 477 Score = 32.3 bits (72), Expect = 0.51 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 197 SGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 + A+ ++V PP AA T+ AL P PPPPP Sbjct: 99 AAAAAAAAAAVVTAPPAPAAASTVDTAALKQPPAPPPPPP 138
>MAZ_MESAU (P56670) Myc-associated zinc finger protein (MAZI) (Purine-binding| transcription factor) (Pur-1) (Fragment) Length = 331 Score = 32.3 bits (72), Expect = 0.51 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 197 SGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 + A+ ++V PP AA T+ AL P PPPPP Sbjct: 86 AAAAAAAAAAVVTAPPAPAAASTVDTAALKQPPAPPPPPP 125
>HD_HUMAN (P42858) Huntingtin (Huntington disease protein) (HD protein)| Length = 3144 Score = 32.0 bits (71), Expect = 0.67 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPPQL P L+ P PPPPP Sbjct: 49 PPPQLPQPPPQAQPLLPQPQPPPPPP 74
>MAZ_HUMAN (P56270) Myc-associated zinc finger protein (MAZI) (Purine-binding| transcription factor) (Pur-1) (ZF87) (ZIF87) Length = 477 Score = 32.0 bits (71), Expect = 0.67 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 197 SGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 + A+ ++V PP AA T+ AL P PPPPP Sbjct: 99 AAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPP 138
>DR111_ARATH (P42698) DNA-damage-repair/toleration protein DRT111, chloroplast| precursor Length = 387 Score = 31.6 bits (70), Expect = 0.87 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 5/41 (12%) Frame = +2 Query: 206 ASRLLSSVFRKPP----PQLAAPTLSEPA-LVDAPYSPPPP 313 ++++ RKPP PQ L++P +V APY PPPP Sbjct: 29 STKMAPPTLRKPPAFAPPQTILRPLNKPKPIVSAPYKPPPP 69
>SALL3_HUMAN (Q9BXA9) Sal-like protein 3 (Zinc finger protein SALL3) (hSALL3)| Length = 1300 Score = 31.6 bits (70), Expect = 0.87 Identities = 24/58 (41%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +3 Query: 63 PPREARSVGALPSAP---QLRHPMRARLPLFIQRHAAAKGVAGSPVSSPVAHRVSSPL 227 PPR + S A PSAP + P A LPL AAA +AGS ++P A + PL Sbjct: 237 PPRPSLSPAAAPSAPGPAPSQLPGLAALPLSAGAPAAA--IAGSGPAAPAAFEGAQPL 292
>G3PT_MOUSE (Q64467) Glyceraldehyde-3-phosphate dehydrogenase, testis-specific| (EC 1.2.1.12) (Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2) (GAPDH-2) Length = 440 Score = 30.8 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 227 VFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 V R PPP+L P P + + P PPPPP Sbjct: 35 VIRPPPPKLEDP---PPTVEEQPPPPPPPP 61 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP P + +AP PPPPP Sbjct: 66 PPPPPPPPQIEPDKFEEAPPPPPPPP 91
>ADA2C_HUMAN (P18825) Alpha-2C adrenergic receptor (Alpha-2C adrenoceptor)| (Alpha-2C adrenoreceptor) (Alpha-2 adrenergic receptor subtype C4) Length = 462 Score = 30.4 bits (67), Expect = 1.9 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 223 GEETRCATGDETGEPATPFAAA*RWMNRGSRARIG*RSCGAEGRA 89 GE CA EP AAA R RG+ R G R GAEG A Sbjct: 271 GENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGA 315
>SPR1_HUMAN (Q15743) Sphingosylphosphorylcholine receptor (Ovarian cancer| G-protein coupled receptor 1) (OGR-1) (G-protein coupled receptor 68) (GPR12A) Length = 365 Score = 30.4 bits (67), Expect = 1.9 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -2 Query: 380 LSVDRLLAVPPPFLLQECRSLKAAAAAS 297 +SVDR LAV PF + R+LKAA S Sbjct: 115 ISVDRYLAVAHPFRFHQFRTLKAAVGVS 142
>TTP_HUMAN (P26651) Tristetraproline (TTP) (Zinc finger protein 36 homolog)| (Zfp-36) (TIS11A protein) (TIS11) (Growth factor-inducible nuclear protein NUP475) (G0/G1 switch regulatory protein 24) Length = 326 Score = 30.4 bits (67), Expect = 1.9 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP LA P+LS + +P S PPPP Sbjct: 199 PPPGLAGPSLSSSSF--SPSSSPPPP 222
>SPR1_MOUSE (Q8BFQ3) Sphingosylphosphorylcholine receptor (G-protein coupled| receptor 68) Length = 365 Score = 30.0 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 380 LSVDRLLAVPPPFLLQECRSLKAAAAAS 297 +S+DR LAV PF + R+LKAA S Sbjct: 115 ISIDRYLAVAHPFRFHQFRTLKAAVGVS 142
>RK5_ORYSA (Q9ZST0) 50S ribosomal protein L5, chloroplast precursor (Fragment)| Length = 280 Score = 30.0 bits (66), Expect = 2.5 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 197 SGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 + +SR + + R PPP+ A ++ A DAP P PPP Sbjct: 21 TASSSRNVRLLLRSPPPRRAL-RVAASAAADAPPKPAPPP 59
>BBC1_YEAST (P47068) Myosin tail region-interacting protein MTI1 (BBC1 protein)| Length = 1157 Score = 30.0 bits (66), Expect = 2.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PP A P LS P++ P +PP PP Sbjct: 734 PPVSSAPPALSAPSIPPVPPTPPAPP 759
>KAPB_BACSU (Q08429) Kinase-associated lipoprotein B precursor| Length = 128 Score = 30.0 bits (66), Expect = 2.5 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 39 LGEVTKAAPPREARSVGAL---PSAPQLRHPMRARLPLFIQRHAAAKG 173 +GE+T P V A+ P+ L HP +A +P F +R A A G Sbjct: 20 IGEITACRPQHYLVKVKAVLTHPAQGDLHHPKQADVPFFHERKALAYG 67
>ERO12_SCHPO (Q9Y7P1) ERO1-like protein 2 precursor (EC 1.8.4.-) (Endoplasmic| oxidoreductin-1-like protein B) Length = 571 Score = 30.0 bits (66), Expect = 2.5 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 206 ASRLLSSVFRKPPPQLAAPTLSEPAL-VDAPYSPPPPP 316 ++R+ ++ + P +APT+ PAL + P +PPP P Sbjct: 201 STRIWEMIYNQCLPDSSAPTIDFPALFMQGPLAPPPKP 238
>HEM1_MOUSE (Q8VC19) 5-aminolevulinate synthase, nonspecific, mitochondrial| precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-H) Length = 642 Score = 30.0 bits (66), Expect = 2.5 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 146 HPASRCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPAL-VDAPYSPPPP 313 HP+ S+GSG ++ S+ SSVFRK +L A+ +A SP PP Sbjct: 97 HPSPATSQGSGSKCPFLAAQLSQTGSSVFRKASLELQEDVQEMHAVRKEAAQSPVPP 153
>RX_HUMAN (Q9Y2V3) Retinal homeobox protein Rx (Retina and anterior neural| fold homeobox protein) Length = 346 Score = 30.0 bits (66), Expect = 2.5 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = +2 Query: 149 PASRCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 PA WL + GG + L S+ PP + P A Y+PPPPP Sbjct: 234 PAGGALPLESWLGPPLPGGGATALQSLPGFGPPAQSLP---------ASYTPPPPP 280
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 30.0 bits (66), Expect = 2.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP + +P + P +V P +P PPP Sbjct: 220 PPPYVPSPPVVTPPIVPTPPTPCPPP 245
>DDR1_PANTR (Q7YR43) Epithelial discoidin domain-containing receptor 1| precursor (EC 2.7.10.1) (Epithelial discoidin domain receptor 1) (Tyrosine kinase DDR) (Discoidin receptor tyrosine kinase) (CD167a antigen) Length = 909 Score = 29.6 bits (65), Expect = 3.3 Identities = 25/71 (35%), Positives = 29/71 (40%), Gaps = 15/71 (21%) Frame = +2 Query: 146 HPASRCSEGSGWLARLISGGASRLLSSVFRKPP-------PQLAAPT--------LSEPA 280 H A GS A L+S A RLL + + +PP P A PT EP Sbjct: 491 HSAPCVPNGS---ALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPE 547 Query: 281 LVDAPYSPPPP 313 AP PPPP Sbjct: 548 KPGAPLLPPPP 558
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 29.6 bits (65), Expect = 3.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP L P S P + P + PPPP Sbjct: 402 PPPPLTPPAPSPPPPLPPPSTSPPPP 427 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP L P+ S P P PPPPP Sbjct: 413 PPPPLPPPSTSPPP----PLCPPPPP 434
>EXTN_SORBI (P24152) Extensin precursor (Proline-rich glycoprotein)| Length = 283 Score = 29.6 bits (65), Expect = 3.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 236 KPPPQLAAPTLSEPALVDAPYSPPPPP 316 KP P P P + P SPPPPP Sbjct: 252 KPSPPAPTPPTYTPPVSHTPSSPPPPP 278
>WASF2_HUMAN (Q9Y6W5) Wiskott-Aldrich syndrome protein family member 2| (WASP-family protein member 2) (WAVE-2 protein) (Verprolin homology domain-containing protein 2) Length = 498 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 209 SRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 S ++S P P L +P +P P PPPPP Sbjct: 292 SSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPP 327 Score = 29.3 bits (64), Expect = 4.3 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVD----APYSPPPPP 316 PPP PTL P L AP PPPPP Sbjct: 369 PPPAADYPTLPPPPLSQPTGGAPPPPPPPP 398
>WT1_PIG (O62651) Wilms' tumor protein homolog| Length = 449 Score = 29.6 bits (65), Expect = 3.3 Identities = 22/56 (39%), Positives = 24/56 (42%) Frame = +2 Query: 149 PASRCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 PA G G A +SG A F PP A +L PA AP PPPPP Sbjct: 13 PAVPSLGGGGGCALPVSGAAEWAPVLDFA-PPGASAYGSLGGPAPPPAPPPPPPPP 67
>WT1_HUMAN (P19544) Wilms' tumor protein (WT33)| Length = 449 Score = 29.6 bits (65), Expect = 3.3 Identities = 22/56 (39%), Positives = 24/56 (42%) Frame = +2 Query: 149 PASRCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 PA G G A +SG A F PP A +L PA AP PPPPP Sbjct: 13 PAVPSLGGGGGCALPVSGAAQWAPVLDFA-PPGASAYGSLGGPAPPPAPPPPPPPP 67
>DDR1_MOUSE (Q03146) Epithelial discoidin domain-containing receptor 1| precursor (EC 2.7.10.1) (Epithelial discoidin domain receptor 1) (Tyrosine kinase DDR) (Discoidin receptor tyrosine kinase) (Tyrosine-protein kinase CAK) (Cell adhesion kinase) (Protei Length = 911 Score = 29.6 bits (65), Expect = 3.3 Identities = 25/71 (35%), Positives = 29/71 (40%), Gaps = 15/71 (21%) Frame = +2 Query: 146 HPASRCSEGSGWLARLISGGASRLLSSVFRKPP-------PQLAAPT--------LSEPA 280 H A GS A L+S A RLL + + +PP P A PT EP Sbjct: 493 HSAPCVPNGS---ALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQACSGDYMEPE 549 Query: 281 LVDAPYSPPPP 313 AP PPPP Sbjct: 550 KPGAPLLPPPP 560
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 29.6 bits (65), Expect = 3.3 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 230 FRKPPPQLAAPTLSEPALVDAP--YSPPPPP 316 + PPP A P P P YSPPPPP Sbjct: 416 YSPPPPTYAQPPPLPPTYSPPPPAYSPPPPP 446 Score = 29.3 bits (64), Expect = 4.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAP--YSPPPPP 316 PPP P S P P YSPPPPP Sbjct: 332 PPPPTYLPLPSSPIYSPPPPVYSPPPPP 359 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 230 FRKPPPQLAAP--TLSEPALVDAPYSPPPP 313 + PPP + P T ++P + YSPPPP Sbjct: 409 YSPPPPTYSPPPPTYAQPPPLPPTYSPPPP 438 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAP---YSPPPP 313 PPP +P L P P YSPPPP Sbjct: 394 PPPPAYSPPLPAPPTYSPPPPTYSPPPP 421
>LECT_SOLTU (Q9S8M0) Chitin-binding lectin 1 precursor (PL-I)| Length = 323 Score = 29.6 bits (65), Expect = 3.3 Identities = 17/57 (29%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +2 Query: 158 RCSEGSGWLARLISGGASRLLSSVFR----KPPPQLAAPTLSEPALVDAPYSPPPPP 316 +C GW AS+ S + PPP +P P P PPPPP Sbjct: 123 QCCSNGGWCGTTSDYCASKNCQSQCKLPSPPPPPPPPSPPPPSPPSPPPPSPPPPPP 179
>ABI1_HUMAN (Q8IZP0) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Spectrin| SH3 domain-binding protein 1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (e3B1) (Nap1-binding protein) (Nap1BP) (Abl-binding protein 4) (AblBP4) Length = 507 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 194 ISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 ++G +R+ ++ P P P P D+P PPPPP Sbjct: 377 LTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPP 417
>ABI1_MOUSE (Q8CBW3) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Spectrin| SH3 domain-binding protein 1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (e3B1) (Ablphilin-1) Length = 480 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 194 ISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 ++G +R+ ++ P P P P D+P PPPPP Sbjct: 350 LTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPP 390
>DDR1_HUMAN (Q08345) Epithelial discoidin domain-containing receptor 1| precursor (EC 2.7.10.1) (Epithelial discoidin domain receptor 1) (Tyrosine kinase DDR) (Discoidin receptor tyrosine kinase) (Tyrosine-protein kinase CAK) (Cell adhesion kinase) (TRK E) Length = 913 Score = 29.6 bits (65), Expect = 3.3 Identities = 25/71 (35%), Positives = 29/71 (40%), Gaps = 15/71 (21%) Frame = +2 Query: 146 HPASRCSEGSGWLARLISGGASRLLSSVFRKPP-------PQLAAPT--------LSEPA 280 H A GS A L+S A RLL + + +PP P A PT EP Sbjct: 495 HSAPCVPNGS---ALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPE 551 Query: 281 LVDAPYSPPPP 313 AP PPPP Sbjct: 552 KPGAPLLPPPP 562
>SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Shank3)| (Proline-rich synapse associated protein 2) (ProSAP2) (SPANK-2) Length = 1815 Score = 29.6 bits (65), Expect = 3.3 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDA----PYSPPPPP 316 PPPQ A P P D+ +SPPPPP Sbjct: 889 PPPQTAPPPPPAPYYFDSGPPPTFSPPPPP 918
>YPRO_OWEFU (P21260) Hypothetical proline-rich protein (Fragment)| Length = 141 Score = 29.6 bits (65), Expect = 3.3 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 212 RLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 RLL S+ PPP P P P PPPPP Sbjct: 2 RLLHSLTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36
>ABI1_RAT (Q9QZM5) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Eps8 SH3| domain-binding protein) (Eps8-binding protein) (e3B1) Length = 475 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 194 ISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 ++G +R+ ++ P P P P D+P PPPPP Sbjct: 345 LTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPP 385
>PFA5_EMENI (Q5B433) Palmitoyltransferase pfa5 (EC 2.3.1.-) (Protein fatty| acyltransferase 5) Length = 474 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP PT D PYSPPP P Sbjct: 316 PPPLSGMPTQPATGEGDNPYSPPPVP 341
>DDR1_RAT (Q63474) Epithelial discoidin domain-containing receptor 1| precursor (EC 2.7.10.1) (Epithelial discoidin domain receptor 1) (Tyrosine kinase DDR) (Discoidin receptor tyrosine kinase) (Tyrosine-protein kinase CAK) (Cell adhesion kinase) (Protein- Length = 910 Score = 29.6 bits (65), Expect = 3.3 Identities = 25/71 (35%), Positives = 29/71 (40%), Gaps = 15/71 (21%) Frame = +2 Query: 146 HPASRCSEGSGWLARLISGGASRLLSSVFRKPP-------PQLAAPT--------LSEPA 280 H A GS A L+S A RLL + + +PP P A PT EP Sbjct: 492 HSAPCVPNGS---ALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQACSGDYMEPE 548 Query: 281 LVDAPYSPPPP 313 AP PPPP Sbjct: 549 KPGAPLLPPPP 559
>SEPA_EMENI (P78621) Cytokinesis protein sepA (FH1/2 protein) (Forced expression| inhibition of growth A) Length = 1790 Score = 29.3 bits (64), Expect = 4.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP A P LS A P PPPPP Sbjct: 1020 PPPPPAHPGLSGAAPPPPPPPPPPPP 1045
>ACROL_HUMAN (P58840) Hypothetical acrosin-like protease (EC 3.4.21.-)| (Fragment) Length = 232 Score = 29.3 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +2 Query: 179 WLARLISGGASRLLSSVFRKPP---PQLAAPTLSEPALVDAPYSPPPPP 316 W+A I A R++ S PP P P S P P+ PPP Sbjct: 95 WIASKIGSNALRMIQSATPPPPTTRPPPIRPPFSHPLSAHLPWYFQPPP 143
>NO75_SOYBN (P08297) Early nodulin 75 precursor (N-75) (NGM-75)| Length = 309 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 230 FRKPPPQLAAPTLSEPALVDAPYSPPP 310 F +PPP PT P PY PPP Sbjct: 32 FYEPPPIEKPPTYEPPPFYKPPYYPPP 58 Score = 28.9 bits (63), Expect = 5.7 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 236 KPPPQLAAPTLSEPALVDAPYSPPPP 313 KPPP P P + + PY PPP Sbjct: 246 KPPPVYPPPYEKPPPVYEPPYEKPPP 271 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 236 KPPPQLAAPTLSEPALVDAPYSPPPP 313 KPPP+ P P + PY PPP Sbjct: 235 KPPPEHQPPHEKPPPVYPPPYEKPPP 260
>BARH2_HUMAN (Q9NY43) BarH-like 2 homeobox protein| Length = 387 Score = 29.3 bits (64), Expect = 4.3 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +2 Query: 233 RKPPPQLAAPTLSEPALVD-----APYSPPPPP 316 ++PPP AAPT S L P PPPPP Sbjct: 92 QQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPP 124
>ACRO_HUMAN (P10323) Acrosin precursor (EC 3.4.21.10) [Contains: Acrosin light| chain; Acrosin heavy chain] Length = 421 Score = 29.3 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +2 Query: 179 WLARLISGGASRLLSSVFRKPP---PQLAAPTLSEPALVDAPYSPPPPP 316 W+A I A R++ S PP P P S P P+ PPP Sbjct: 284 WIASKIGSNALRMIQSATPPPPTTRPPPIRPPFSHPISAHLPWYFQPPP 332
>CG1_HUMAN (Q13495) CG1 protein (F18)| Length = 701 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP L+ P+ P+L P PPPP Sbjct: 259 PPPGLSPPSRPVPSLQPPPLPLPPPP 284
>SOT1_SPIOL (Q41364) 2-oxoglutarate/malate translocator, chloroplast precursor| Length = 569 Score = 29.3 bits (64), Expect = 4.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 242 PPQLAAPTLSEPALVDAPYSPPPPP 316 PP L P +P +P +PPPPP Sbjct: 57 PPSLLLPHKLKPISASSPTNPPPPP 81
>Y980_MYCBO (P64772) Hypothetical protein Mb0980| Length = 455 Score = 29.3 bits (64), Expect = 4.3 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 176 GWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPA-LVDAPYSPPPP 313 GW+ +I+GG SR + PP +L A S P + D S PP Sbjct: 370 GWVTVVIAGGISRRPKRLRPAPPVELDADESSPPVDMFDGAASEQPP 416
>Y955_MYCTU (P64771) Hypothetical protein Rv0955/MT0982| Length = 455 Score = 29.3 bits (64), Expect = 4.3 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 176 GWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPA-LVDAPYSPPPP 313 GW+ +I+GG SR + PP +L A S P + D S PP Sbjct: 370 GWVTVVIAGGISRRPKRLRPAPPVELDADESSPPVDMFDGAASEQPP 416
>VP61_NPVAC (Q03209) 61 kDa protein| Length = 543 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP A P + P +VD +PPPPP Sbjct: 284 PPPPPAPP--APPPMVDLSSAPPPPP 307
>MMPS3_MYCTU (P65378) Putative membrane protein mmpS3| Length = 299 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP PT +E V PPPPP Sbjct: 159 PPPTTEIPTATETQTVTVTPPPPPPP 184
>MMPS3_MYCBO (P65379) Putative membrane protein mmpS3| Length = 299 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP PT +E V PPPPP Sbjct: 159 PPPTTEIPTATETQTVTVTPPPPPPP 184
>WASF2_MOUSE (Q8BH43) Wiskott-Aldrich syndrome protein family member 2| (WASP-family protein member 2) (WAVE-2 protein) Length = 497 Score = 29.3 bits (64), Expect = 4.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 P P L++P +P P PPPPP Sbjct: 302 PAPPLSSPPGPKPGFAPPPAPPPPPP 327
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2161 Score = 29.3 bits (64), Expect = 4.3 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 5/31 (16%) Frame = +2 Query: 239 PPPQLA-----APTLSEPALVDAPYSPPPPP 316 PPP+ A P+ +EPA P PPPPP Sbjct: 384 PPPKTAWTENSRPSETEPAAPPIPKPPPPPP 414
>CCD45_MOUSE (Q8BVV7) Coiled-coil domain-containing protein 45| Length = 827 Score = 28.9 bits (63), Expect = 5.7 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = +3 Query: 39 LGEVTKAAPPREARS----VGALPSAPQLRHPMRARLPLFIQRH 158 LG +++ PP EA S + +PSA +L P+RA +PL H Sbjct: 225 LGFLSQNGPPCEAASETPPMSMVPSARKLGEPIRAAIPLHPPYH 268
>S2A4R_HUMAN (Q9NR83) SLC2A4 regulator (GLUT4 enhancer factor) (GEF) (Huntington| disease gene regulatory region-binding protein 1) (HDBP-1) Length = 387 Score = 28.9 bits (63), Expect = 5.7 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 194 ISGGASRL--LSSVFRKPP--PQLAAPTLSEPALVDAPYSPPPPP 316 ++ G S L +S PP P+L P L EP + +P PP PP Sbjct: 253 LTDGLSSLTPVSPTASMPPAFPRLELPELLEPPALPSPLRPPAPP 297
>PF12_PIG (P51525) Prophenin-2 precursor (PF-2) (PR-2) (C12)| (Prophenin-1-like) Length = 228 Score = 28.9 bits (63), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 233 RKPPPQLAAPTLSEPALVDAPYSPPPPP 316 R PPP P P + P+ PPPPP Sbjct: 187 RFPPPNFPGPPF-PPPIFPGPWFPPPPP 213
>WT1_MOUSE (P22561) Wilms' tumor protein homolog| Length = 449 Score = 28.9 bits (63), Expect = 5.7 Identities = 20/56 (35%), Positives = 23/56 (41%) Frame = +2 Query: 149 PASRCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 PA G G L GA + + PP A +L PA AP PPPPP Sbjct: 13 PAVSSLGGGGGGCGLPVSGARQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPP 68
>PRCC_HUMAN (Q92733) Proline-rich protein PRCC (Papillary renal cell carcinoma| translocation associated gene protein) Length = 491 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAP-----YSPPPP 313 PPPQ+ AP P L+ P PPPP Sbjct: 53 PPPQMLAPAFPPPLLLPPPTGDPRLQPPPP 82
>LEU3_RHILO (Q98E57) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 367 Score = 28.9 bits (63), Expect = 5.7 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = +3 Query: 81 SVGALPSA----PQLRHPMRARLPLFIQRHAAAKGVAGSPVSSPVAHRVSSPLC 230 S+G LPSA P ++ + R L+ H +A +AG +++P+A S +C Sbjct: 262 SIGMLPSASLGAPDVK--TKKRKALYEPVHGSAPDIAGKGIANPIAMIASFAMC 313
>HNRL1_HUMAN (Q9BUJ2) Heterogeneous nuclear ribonucleoprotein U-like protein 1| (Adenovirus early region 1B-associated protein 5) (E1B-55 kDa-associated protein 5) (E1B-AP5) Length = 856 Score = 28.9 bits (63), Expect = 5.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 200 GGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 GG S+ ++ PPP A S APY+PPPPP Sbjct: 765 GGYSQGYTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPP 803
>PF11_PIG (P51524) Prophenin-1 precursor (PF-1) (C6) (Fragment)| Length = 212 Score = 28.9 bits (63), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 233 RKPPPQLAAPTLSEPALVDAPYSPPPPP 316 R PPP P P + P+ PPPPP Sbjct: 171 RFPPPNFPGPPF-PPPIFPGPWFPPPPP 197
>POLR_OYMV (P20127) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1776 Score = 28.9 bits (63), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 227 VFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 +FR PPP A T S PA P + PP P Sbjct: 552 IFRVPPPLPAQETPSPPAPALVPPTQPPQP 581
>AREA_ASPOR (O13415) Nitrogen regulatory protein areA| Length = 866 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 57 AAPPREARSVGALPSAPQLRHPMRA 131 AAPP+ A S A PS Q R+P++A Sbjct: 777 AAPPKAAPSAAASPSTGQTRNPIQA 801
>YDC9_SCHPO (Q10172) Hypothetical protein C25G10.09c in chromosome I| Length = 1794 Score = 28.9 bits (63), Expect = 5.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP P S P + P S PPPP Sbjct: 1709 PPPMSVPPPPSAPPMPAGPPSAPPPP 1734
>LBD13_ARATH (Q9AT61) LOB domain protein 13| Length = 268 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 218 LSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 L+S PPP PT P L+ + +PPP P Sbjct: 186 LASAILLPPPPPPPPTPRPPRLLSSQPAPPPTP 218
>ZBTB4_HUMAN (Q9P1Z0) Zinc finger and BTB domain-containing protein 4| (KAISO-like zinc finger protein 1) (KAISO-L1) Length = 1013 Score = 28.9 bits (63), Expect = 5.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 206 ASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 A R + + P +PTL+ PA V P SPPP P Sbjct: 423 AKRPYKTYSQGAPEAPLSPTLNTPAPVAMPASPPPGP 459
>PTK1_YEAST (P36002) Serine/threonine-protein kinase PTK1/STK1 (EC 2.7.11.1)| Length = 649 Score = 28.9 bits (63), Expect = 5.7 Identities = 15/26 (57%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 239 PPPQLAAPTLS-EPALVDAPYSPPPP 313 PPPQLA TLS EP AP +P P Sbjct: 599 PPPQLATLTLSEEPPATPAPSAPSAP 624
>MAPK2_HUMAN (P49137) MAP kinase-activated protein kinase 2 (EC 2.7.11.1)| (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAPK-2) (MK2) Length = 400 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPPQ P L P P PPPPP Sbjct: 19 PPPQPPTPALPHP-----PAQPPPPP 39
>PRP28_ASPOR (Q2UH00) Pre-mRNA splicing ATP-dependent RNA helicase prp28 (EC| 3.6.1.-) Length = 803 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 224 SVFRKPPPQLAAPTLSEPALVDAPYSPPPP 313 SV PPP++ AP P D P +PPPP Sbjct: 36 SVAPPPPPEVVAP---PPPPEDLPPAPPPP 62
>DAZP1_XENLA (Q98SJ2) DAZ-associated protein 1 (Deleted in| azoospermia-associated protein 1) (Proline-rich Vg1 mRNA-binding protein) Length = 360 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPPQ P + P Y PPPPP Sbjct: 274 PPPQGFPPGYATPPPFGYGYGPPPPP 299
>GR65_MOUSE (Q91X51) Golgi reassembly-stacking protein 1 (Golgi| reassembly-stacking protein of 65 kDa) (GRASP65) (Golgi peripheral membrane protein p65) Length = 445 Score = 28.5 bits (62), Expect = 7.4 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -1 Query: 276 GSESVGAASCGGGLRNTEERRRDAPPEMR 190 GS S GAA CGG LR E + PP R Sbjct: 275 GSPSHGAADCGGCLRAMEIPLQPPPPVQR 303
>ABI2_HUMAN (Q9NYB9) Abl interactor 2 (Abelson interactor 2) (Abi-2)| (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1) Length = 513 Score = 28.5 bits (62), Expect = 7.4 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +2 Query: 149 PASRCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPP 313 P S S+ S L ++GG + V PPP P + EP ++P PPPP Sbjct: 374 PPSITSQTS--LQNQMNGGPFYSQNPVSDTPPPP---PPVEEPVFDESPPPPPPP 423
>CCNK_MOUSE (O88874) Cyclin-K| Length = 554 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP AP P L P+ PPPPP Sbjct: 404 PPPAHPAPVHQPPPL---PHRPPPPP 426
>RNH2_COREF (Q8FP63) Ribonuclease HII (EC 3.1.26.4) (RNase HII)| Length = 231 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 63 PPREARSVGALPSAPQLRHPMRARLPLFIQRHAAAKGV 176 P R + L + QL P+RARL +++HA A V Sbjct: 48 PDRPIADLAVLTDSKQLSPPVRARLMPLVKKHAVAWSV 85
>GLMS_COREF (Q8FNH2) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 622 Score = 28.5 bits (62), Expect = 7.4 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = +3 Query: 21 GAVTWRLGEVTKAAPPREARSVGALPSAPQLRHPMRARLPLFIQRHAAA 167 GAVT + E A A + +P AP L P+ A +PL I A A Sbjct: 554 GAVTIVIAEEGDTAVDEHANYIIRIPQAPTLMQPLLATVPLQIFACAVA 602
>FRAH_ANASP (P46017) Protein fraH| Length = 289 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPP 313 PP +AAP + P +V+ +PPPP Sbjct: 108 PPTAVAAPPDATPVVVEVTPAPPPP 132
>GLMS_CORDI (Q6NG33) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 624 Score = 28.5 bits (62), Expect = 7.4 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +3 Query: 21 GAVTWRLGEVTKAAPPREARSVGALPSAPQLRHPMRARLPL--FIQRHAAAKG 173 GA+T + E A A + +P AP L P+ A +PL F AAAKG Sbjct: 556 GAITIVIAEEGDDAVEAYANHIIRIPQAPTLMQPLLATVPLQIFACGVAAAKG 608
>SOS2_HUMAN (Q07890) Son of sevenless homolog 2 (SOS-2)| Length = 1332 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 233 RKPPPQLAAPTLSEPA-LVDAP-YSPPPPP 316 R+PPP P + P D P +SPPPPP Sbjct: 1178 RQPPPPKVKPRVPVPTGAFDGPLHSPPPPP 1207
>LARK_DROME (Q94901) RNA-binding protein lark| Length = 352 Score = 28.5 bits (62), Expect = 7.4 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +2 Query: 158 RCSEGSGWLARLISGGASRLLSSVF--RKPPPQLAAPTLSEPALVDAPYSPPPPP 316 RC W S RL S R+PP L+A + PY PPPPP Sbjct: 172 RCGRSGHW-----SKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRDPYPPPPPP 221
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 221 SSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 S V P P AP +P P SPPPPP Sbjct: 243 SPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPP 274 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 242 PPQLAAPTLSEPALVDAPYSPPPPP 316 PP A P+ PA P PPPPP Sbjct: 251 PPSPAPPSPKPPAPPPPPSPPPPPP 275
>RL1_HHV11 (O12396) Neurovirulence factor RL1 (Neurovirulence factor ICP34.5)| Length = 248 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +2 Query: 233 RKPPPQLAAPTL---------SEPALVDAPYSPPPPP 316 R P P A PT SEPA+ AP + PPPP Sbjct: 14 RPPGPTGAVPTAQSQVTSTPNSEPAVRSAPAAAPPPP 50
>ICP34_HHV11 (P36313) Infected cell protein ICP34.5 (Neurovirulence factor| ICP34.5) Length = 248 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +2 Query: 233 RKPPPQLAAPTL---------SEPALVDAPYSPPPPP 316 R P P A PT SEPA+ AP + PPPP Sbjct: 14 RPPGPTGAVPTAQSQVTSTPNSEPAVRSAPAAAPPPP 50
>ENAH_HUMAN (Q8N8S7) Protein enabled homolog| Length = 591 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP P + AL P PPPPP Sbjct: 316 PPPLPPGPAQASVALPPPPGPPPPPP 341
>ATI2_HHV1F (P08314) Alpha trans-inducing factor 77 kDa protein| Length = 715 Score = 28.1 bits (61), Expect = 9.7 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +2 Query: 170 GSGWLARLISGGASRLLSSVFRKPPPQLAAPTLS---EPALVDAPYSPPPPP 316 G G + + SG A + R P P +PTL PA+ +AP P PP Sbjct: 451 GGGTVGKRFSGPARQ------RAPAPPPTSPTLDPRGHPAVPEAPRGRPAPP 496
>TGIF_PANTR (Q5IS58) 5'-TG-3'-interacting factor (Homeobox protein TGIF)| Length = 401 Score = 28.1 bits (61), Expect = 9.7 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 146 HPAS-RCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 HP + +CS + +LA + RL PP L + + AL+ + +PPPPP Sbjct: 34 HPGNPQCSFSTAFLA------SPRLSRGTLAYLPPALWSSLATPSALLGSSCAPPPPP 85
>FOXD1_MOUSE (Q61345) Forkhead box protein D1 (Forkhead-related protein FKHL8)| (Forkhead-related transcription factor 4) (FREAC-4) (Brain factor-2) (HFH-BF-2) Length = 456 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PP L A + A P+SPPPPP Sbjct: 287 PPSALFAAAAAAAAAAFHPHSPPPPP 312
>SF3B2_HUMAN (Q13435) Splicing factor 3B subunit 2 (Spliceosome-associated| protein 145) (SAP 145) (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa subunit) Length = 872 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 239 PPPQLAAPTLSEPALVDAPYSPPPPP 316 PPP L P L P P PPPPP Sbjct: 70 PPPPLGLPPLQPP-----PPPPPPPP 90
>F_HCV1 (P0C044) F protein (Frameshifted protein) (Alternate reading frame| protein/F-protein) (ARFP/F-protein) (ARFP/F) (p16) (p17) Length = 161 Score = 28.1 bits (61), Expect = 9.7 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -2 Query: 134 PGTHRVTQLRRGREGAYGSCLPWRSRLRNLPETPCYG 24 PGT + R G GSCLP L P+TP G Sbjct: 79 PGTLGPSMAMRAAGGRDGSCLPVALGLAGAPQTPGVG 115
>ABI2_MOUSE (P62484) Abl interactor 2 (Abelson interactor 2) (Abi-2)| Length = 446 Score = 28.1 bits (61), Expect = 9.7 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +2 Query: 149 PASRCSEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPP 313 P S S+ S L ++GG + V PPP P + EP ++P PPPP Sbjct: 307 PPSITSQTS--LQNQMNGGPFYNQNPVSDTPPPP---PPVEEPVFDESPPPPPPP 356
>WT1_RAT (P49952) Wilms' tumor protein homolog| Length = 448 Score = 28.1 bits (61), Expect = 9.7 Identities = 19/51 (37%), Positives = 22/51 (43%) Frame = +2 Query: 164 SEGSGWLARLISGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 S G G L GA + + PP A +L PA AP PPPPP Sbjct: 17 SLGGGGGCGLPVSGARQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPP 67
>SHAN2_RAT (Q9QX74) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)| (Proline-rich synapse-associated protein 1) (ProSAP1) (Cortactin-binding protein 1) (CortBP1) (GKAP/SAPAP-interacting protein) (SPANK-3) Length = 1474 Score = 28.1 bits (61), Expect = 9.7 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 Query: 197 SGGASRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPP 307 +G + FR PPP LA+ L E L P PP Sbjct: 1003 AGSVEEAVILPFRIPPPPLASVDLDEDFLFTEPLPPP 1039
>PCD15_HUMAN (Q96QU1) Protocadherin-15 precursor| Length = 1955 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 254 AAPTLSEPALVDAPYSPPPPP 316 A P + PA V AP PPPPP Sbjct: 1422 AKPAVPAPAPVAAPPPPPPPP 1442
>TONB_XANCP (O34261) Protein tonB| Length = 223 Score = 28.1 bits (61), Expect = 9.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 215 LLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPPP 316 L+ +V K P + T+ LVDAP PPPPP Sbjct: 42 LIPAVAPKAPAEKERTTMV--TLVDAPPPPPPPP 73
>K1543_MOUSE (Q80VC9) Protein KIAA1543| Length = 1252 Score = 28.1 bits (61), Expect = 9.7 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +3 Query: 42 GEVTKAAPPREARSVGALPSAPQLRHPMRARLPLFIQRH-----AAAKGVAGSPVSSPVA 206 GE+ K PP E S A+ S+P + ++ F +R A A+ GSP S+PVA Sbjct: 536 GEILKPPPPSEG-SPKAVASSPAANNS-EVKMTSFAERKKQLVKAEAESGLGSPTSTPVA 593
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 209 SRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPP 313 S L +S+ PPP + P + AP PPPP Sbjct: 338 SSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPP 372
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 209 SRLLSSVFRKPPPQLAAPTLSEPALVDAPYSPPPP 313 S L +S+ PPP + P + AP PPPP Sbjct: 338 SSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPP 372
>ICP34_HHV1F (P08353) Infected cell protein ICP34.5 (Neurovirulence factor| ICP34.5) Length = 263 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 9/37 (24%) Frame = +2 Query: 233 RKPPPQLAAPTL---------SEPALVDAPYSPPPPP 316 R P P A PT SEPA+ AP + PPPP Sbjct: 14 RPPGPTGAVPTAQSQVTSTPNSEPAVRSAPAAAPPPP 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,484,906 Number of Sequences: 219361 Number of extensions: 1029216 Number of successful extensions: 6738 Number of sequences better than 10.0: 95 Number of HSP's better than 10.0 without gapping: 4852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6444 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)