| Clone Name | bastl13d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VCAP_SHV21 (Q00999) Major capsid protein (MCP) | 30 | 1.8 | 2 | HEPA_HHV11 (P10192) DNA helicase/primase complex-associated protein | 27 | 9.0 |
|---|
>VCAP_SHV21 (Q00999) Major capsid protein (MCP)| Length = 1371 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 1 LHPTQPVFSSAHEAAARMSEWRSNHRHK**NIPPPNSQRPSQE 129 +HP V++ H+ AA ++R+ HR+ N+PPP + QE Sbjct: 532 VHPFFDVYAERHQGAA--VQYRATHRNLSGNLPPPLAPYSFQE 572
>HEPA_HHV11 (P10192) DNA helicase/primase complex-associated protein| Length = 750 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 274 AWPAVGSECEAAILVWAGV*SVWERWVMPAARRVL 378 AWPAVG+ W GV S ++PA R + Sbjct: 347 AWPAVGARVVLPPRAWPGVASAAAGCLLPAVREAV 381 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,932,936 Number of Sequences: 219361 Number of extensions: 737171 Number of successful extensions: 1970 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1968 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)