| Clone Name | bastl13d02 |
|---|---|
| Clone Library Name | barley_pub |
>RIMS1_MOUSE (Q99NE5) Regulating synaptic membrane exocytosis protein 1| (Rab3-interacting molecule 1) (RIM 1) (Rab3-interacting protein 1) (Fragment) Length = 388 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -2 Query: 84 LLEAGEGGVEERKGKARNETRRMETG 7 +++ GEG +ER+ K R ETRR+E G Sbjct: 319 VVQPGEGTADERERKERRETRRLEKG 344
>RIMS1_RAT (Q9JIR4) Regulating synaptic membrane exocytosis protein 1| (Rab3-interacting molecule 1) (RIM 1) Length = 1615 Score = 30.8 bits (68), Expect = 0.82 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -2 Query: 84 LLEAGEGGVEERKGKARNETRRMETG 7 +++ GEG +ER+ K R ETRR+E G Sbjct: 319 VVQPGEGIADERERKERRETRRLEKG 344
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.8 bits (68), Expect = 0.82 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 17/65 (26%) Frame = +2 Query: 212 SCCTSGD*CVPLSDLGIILR--------AAILKCSVPA*RY---------CFSMLCALLC 340 +CCT+ C P S + ++ R I C PA Y C S+LC C Sbjct: 208 ACCTTSC-CRPSSSVSLLCRPICRPACCVPISSCCAPASSYQASCCRPASCVSLLCRPAC 266 Query: 341 SPFCC 355 SP C Sbjct: 267 SPLAC 271 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 317 SMLCALLCSPFCCLPLRS 370 S+LC +C P CC+P+ S Sbjct: 222 SLLCRPICRPACCVPISS 239
>RIMS1_HUMAN (Q86UR5) Regulating synaptic membrane exocytosis protein 1| (Rab3-interacting molecule 1) (RIM 1) Length = 1692 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 69 EGGVEERKGKARNETRRMETG 7 EG VEER+ K R E+RR+E G Sbjct: 302 EGAVEERERKERRESRRLEKG 322
>Y4YR_RHISN (P55726) Probable translocation protein y4yR| Length = 697 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 1 LVSC-LHPSGFVPGFPLPLFHPTFACF 78 L +C L GFVPGFPLP+F A F Sbjct: 287 LAACVLVAMGFVPGFPLPVFFMLAAVF 313
>SYA_BUCBP (P59420) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 223 IRRLVRSTIRPGYHSACGHPEVLGAGIALLFLHALCPPLFAFLLSSSPVI 372 +RR++R IR G++ GI LFLH L P L + +PV+ Sbjct: 310 LRRIIRRAIRHGHN----------LGIKSLFLHKLIPTLINTMGKFNPVL 349
>PUR2_YEAST (P07244) Bifunctional purine biosynthetic protein ADE5,7 [Includes:| Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cycl Length = 802 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 205 NNLVLHIRRLVRSTIRPGYHSACG 276 NNLV I+ +VRST RPG S G Sbjct: 463 NNLVQTIKEMVRSTRRPGADSDIG 486
>RIR1_HHV23 (P09853) Ribonucleoside-diphosphate reductase large chain (EC| 1.17.4.1) (Ribonucleotide reductase) (136 kDa subunit) Length = 1144 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 214 VLHIRRLVRSTIRPGYHSACGHPEVLGAGIALLFLHALC 330 VL + ++ ST++P A GH + GI + LH C Sbjct: 844 VLMVNIMIDSTLQPTPQCARGHDNLRSMGIGMQGLHTAC 882
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 317 SMLCALLCSPFCCLPLRS 370 S+LC +C P CC+P+ S Sbjct: 233 SLLCRPVCRPACCMPVSS 250
>Y675_TREPA (O83681) Hypothetical protein TP0675| Length = 332 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +2 Query: 263 ILRAAILK-CSVPA*RYCFSMLCALLCSPF--CCLPL 364 +LR +LK CS+ A R LC LL PF CC L Sbjct: 11 LLRRTVLKRCSLCATRCAIVFLCVLLILPFLSCCTSL 47
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 12/78 (15%) Frame = +2 Query: 173 CKETNSWLLIRTISCCTSGD*CVPLSDLGIILRAAILKCSVPA*RYC------------F 316 C ++S+ + C C P+ + + RA+ +C P+ + Sbjct: 178 CCTSSSYQQACCVPVCCKTVYCKPICCVPVCSRASYSRCQQPSCQPACCTTSCCRPSSSV 237 Query: 317 SMLCALLCSPFCCLPLRS 370 S+LC +C CC+P+ S Sbjct: 238 SLLCHPVCRSTCCVPVSS 255
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 317 SMLCALLCSPFCCLPLRS 370 S+LC +C P CC+P+ S Sbjct: 232 SLLCRPVCRPACCVPVSS 249
>CCDC9_MOUSE (Q8VC31) Coiled-coil domain-containing protein 9| Length = 543 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 96 GNPRLLEAGEGGVEERKGKARNETRR 19 G+P LL AG+ +RK K E RR Sbjct: 134 GSPHLLGAGDNSTSDRKSKEWEERRR 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,207,534 Number of Sequences: 219361 Number of extensions: 868467 Number of successful extensions: 2197 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2194 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)