| Clone Name | bastl13c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STB3_ASHGO (Q750U1) Protein STB3 | 30 | 1.1 | 2 | JHD1_YARLI (Q6C423) JmjC domain-containing histone demethylation... | 30 | 1.9 | 3 | CDC31_YEAST (P06704) Cell division control protein 31 (Nucleopor... | 28 | 4.1 | 4 | ZN541_HUMAN (Q9H0D2) Zinc finger protein 541 | 28 | 7.0 | 5 | DLL4_XENLA (P53775) Homeobox protein DLL-4 (XDLL-4) | 28 | 7.0 | 6 | ZN541_MACFA (Q4R2Z8) Zinc finger protein 541 | 27 | 9.2 |
|---|
>STB3_ASHGO (Q750U1) Protein STB3| Length = 511 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 258 QPPWKLSSDQNVIFSARVRSPDSGPARR 175 +PP +LS Q V+F AR+R+P+ G RR Sbjct: 283 EPP-ELSDQQEVLFRARLRAPNGGSRRR 309
>JHD1_YARLI (Q6C423) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 510 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 249 WKLSSDQNVIFSARVRSPDS 190 W LS+DQNV+F V SPDS Sbjct: 293 WCLSADQNVVFLPDVLSPDS 312
>CDC31_YEAST (P06704) Cell division control protein 31 (Nucleoporin CDC31)| (Nuclear pore protein CDC31) Length = 161 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = +2 Query: 161 KNRSILLAGPESGDLTRAEKMTF*SLLSFHGG*QDLRADYILDSEEIKCAM 313 KNRS L +GP + +L +K S D+ D LD E+K AM Sbjct: 3 KNRSSLQSGPLNSELLEEQKQEIYEAFSLF----DMNNDGFLDYHELKVAM 49
>ZN541_HUMAN (Q9H0D2) Zinc finger protein 541| Length = 792 Score = 27.7 bits (60), Expect = 7.0 Identities = 21/67 (31%), Positives = 31/67 (46%) Frame = +3 Query: 150 ATPSRTDRSSSPARSPETSRAPRR*HFDHY*ASTVADKTSVLIIFSIQKKLSAPCQDPTQ 329 A P + SPAR +T+ R + ST D L + ++ L+AP DP++ Sbjct: 59 AGPGNPEAEGSPARRRKTTPGVPR---EASPGSTRRDAKGGLKVAAVPTPLAAPSLDPSR 115 Query: 330 TGMISSL 350 ISSL Sbjct: 116 NPDISSL 122
>DLL4_XENLA (P53775) Homeobox protein DLL-4 (XDLL-4)| Length = 285 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 365 YHPMHQRRYHPCLSWILAWRT*FLLNREYNQHGGLVSHRGSL 240 YH +H+ + P L A + + N++ QH G VS G L Sbjct: 22 YHSLHKSQESPTLPVSTATDSSYYTNQQQQQHCGAVSPYGQL 63
>ZN541_MACFA (Q4R2Z8) Zinc finger protein 541| Length = 803 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = +3 Query: 147 DATPSRTDRSSSPARSPETSRAPRR*HFDHY*ASTVADKTSVLIIFSIQKKLSAPCQDPT 326 +A P + SPAR +T+ R + +T D L + ++ L+AP DP+ Sbjct: 58 NAGPGNPEAEGSPARRRKTTPGVAR---EASPGNTRRDAKGGLKVAAVPTPLAAPSLDPS 114 Query: 327 QTGMISSL 350 + ISSL Sbjct: 115 RNPDISSL 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,392,044 Number of Sequences: 219361 Number of extensions: 518113 Number of successful extensions: 1336 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)