| Clone Name | bastl12g01 |
|---|---|
| Clone Library Name | barley_pub |
>MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (hMAdCAM-1) Length = 406 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 11 TFPNPKCRCGLTHSPRSPLSTRT 79 T P P + G TH+PRSP STRT Sbjct: 292 TSPEPAPQQGSTHTPRSPGSTRT 314
>MSRA3_RHIME (Q92Y45) Peptide methionine sulfoxide reductase msrA 3 (EC 1.8.4.6)| (Protein-methionine-S-oxide reductase 3) (Peptide Met(O) reductase 3) Length = 168 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = +2 Query: 215 PSHNNFLRKLDN---CHFAHPSWV 277 P H N+L + N CHF P+WV Sbjct: 137 PEHQNYLERYPNGYTCHFPRPNWV 160
>MSRA2_RHOBA (Q7UJI2) Peptide methionine sulfoxide reductase msrA 2 (EC 1.8.4.6)| (Protein-methionine-S-oxide reductase 2) (Peptide Met(O) reductase 2) Length = 168 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 3/24 (12%) Frame = +2 Query: 215 PSHNNFLRKLDN---CHFAHPSWV 277 P H ++L K+ N CHF P+WV Sbjct: 137 PEHQDYLEKVPNGYTCHFPRPNWV 160
>FLGI1_BRAJA (Q89I01) Flagellar P-ring protein 1 precursor (Basal body P-ring| protein 1) Length = 374 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 289 QCEVDPGRMCKMAIIQLSQEVVVGRDARIGT 197 Q +VDP K+ I + S +V+GRD R+ T Sbjct: 252 QLQVDPDLAAKIVIDERSGIIVMGRDVRVAT 282
>FLGI_RHOPA (Q6N2Y8) Flagellar P-ring protein precursor (Basal body P-ring| protein) Length = 373 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 289 QCEVDPGRMCKMAIIQLSQEVVVGRDARIGT 197 Q +V+P + K+ I + S +V+GRD R+ T Sbjct: 251 QLQVEPDQAAKIVIDERSGIIVMGRDVRVAT 281
>MCP5_SCHPO (Q9Y7J9) Meiotic coiled-coil protein 5| Length = 968 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 53 PRSPLSTRTHPAGEFKRKRHQREQ 124 P +P +TRT+P E ++ RH Q Sbjct: 758 PSAPKNTRTYPTAEVEKTRHDSSQ 781
>SQSTM_RAT (O08623) Sequestosome-1 (Ubiquitin-binding protein p62) (Protein| kinase C-zeta-interacting protein) (PKC-zeta-interacting protein) Length = 439 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 SHNNFLRKLDNCHFAHPSW 274 SH+ +LRKL + HF P W Sbjct: 177 SHSRWLRKLKHGHFGWPGW 195
>SQSTM_MOUSE (Q64337) Sequestosome-1 (Ubiquitin-binding protein p62) (STONE14)| Length = 442 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 SHNNFLRKLDNCHFAHPSW 274 SH+ +LRKL + HF P W Sbjct: 180 SHSRWLRKLKHGHFGWPGW 198
>UNG_VZVD (P09307) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 305 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 8 TTFPNPKCRCGLTHSPRSPLS 70 TT PN +C LTH+ SPLS Sbjct: 255 TTQPNSRCHLVLTHAHPSPLS 275
>ETV6_MOUSE (P97360) Transcription factor ETV6 (ETS-related protein Tel1) (Tel)| (ETS translocation variant 6) Length = 485 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 41 LTHSPRSPLSTRTHPAGEFKRKRHQR 118 L H PRSP++T P+ + +++R QR Sbjct: 179 LLHRPRSPITTNHRPSPDPEQQRPQR 204
>MSRA1_RHILO (Q98JV5) Peptide methionine sulfoxide reductase msrA 1 (EC 1.8.4.6)| (Protein-methionine-S-oxide reductase 1) (Peptide Met(O) reductase 1) Length = 172 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/23 (43%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +2 Query: 215 PSHNNFLRKLDN---CHFAHPSW 274 P H ++L K N CHF P W Sbjct: 140 PEHQDYLEKYPNGYTCHFVRPGW 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,163,040 Number of Sequences: 219361 Number of extensions: 472209 Number of successful extensions: 1135 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)