| Clone Name | bastl12f06 |
|---|---|
| Clone Library Name | barley_pub |
>CATE_HUMAN (P14091) Cathepsin E precursor (EC 3.4.23.34)| Length = 401 Score = 30.0 bits (66), Expect = 3.2 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 2/74 (2%) Frame = -3 Query: 304 GYPAVAV--VHPFLERIIDRNLVFRDSFDV*SKHFENQGYNCQYISGHAKHSNLLAFIIE 131 GYP++AV V P + ++ +NLV F V G + I G HS+ + Sbjct: 193 GYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNW 252 Query: 130 FPLPSYCWWLSTVD 89 P+ +W +D Sbjct: 253 VPVTKQAYWQIALD 266
>GLMU_MANSM (Q65R54) Bifunctional protein glmU [Includes:| UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)] Length = 457 Score = 29.6 bits (65), Expect = 4.2 Identities = 19/37 (51%), Positives = 21/37 (56%) Frame = +1 Query: 19 ELAPSSVSEDGDFGARASKGTFARRLCSATSNNLAEE 129 E+ P SV ED GARAS G F+R A LAEE Sbjct: 309 EIKPYSVFEDSTIGARASIGPFSRLRPGA---ELAEE 342
>Y968_MYCBO (P64766) Hypothetical protein Mb0968c| Length = 346 Score = 29.3 bits (64), Expect = 5.5 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 44 KMGTSELEQAKARLHVDCAQPPAITWQRKFDDEGKKVAML 163 + G +L + +AR + +P + W R FD GK++A++ Sbjct: 9 RRGHRKLVRFQARRAIGPIRPTSAAWDRDFDPAGKRIAVV 48
>Y943_MYCTU (P64765) Hypothetical protein Rv0943c/MT0969| Length = 346 Score = 29.3 bits (64), Expect = 5.5 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 44 KMGTSELEQAKARLHVDCAQPPAITWQRKFDDEGKKVAML 163 + G +L + +AR + +P + W R FD GK++A++ Sbjct: 9 RRGHRKLVRFQARRAIGPIRPTSAAWDRDFDPAGKRIAVV 48
>CSN7B_MOUSE (Q8BV13) COP9 signalosome complex subunit 7b (Signalosome subunit| 7b) (SGN7b) (JAB1-containing signalosome subunit 7b) Length = 264 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 262 SSQEMDGQLLPRGTPRRTRFRKYRKKLQRVLSAVSN 369 S+QEM+ QL R P T R+ KK+ +V VS+ Sbjct: 227 SAQEMEQQLAERECPPHTEQRQPTKKMSKVKGLVSS 262
>NARI_BACSU (P42177) Nitrate reductase gamma chain (EC 1.7.99.4)| Length = 223 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +2 Query: 95 CAQPPAITWQRKFDDEGKKVAMLSMATDILTIIPLIFKML 214 C +T++R FD K++ S +DILT++ L+F ML Sbjct: 101 CTGLVILTYRRLFD---KRIRKTSSPSDILTLLLLLFMML 137
>CHD4_MOUSE (Q6PDQ2) Chromodomain helicase-DNA-binding protein 4 (CHD-4)| Length = 1915 Score = 28.5 bits (62), Expect = 9.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 2 GLQVQPNWLLHRSLKMGTSELEQAKARLHVDCAQPPA 112 G++++ N L G E++ V+CAQPPA Sbjct: 1556 GIKIEENSLKEEESTEGEKEVKSTAPEATVECAQPPA 1592
>MDE10_SCHPO (O13766) Zinc metalloprotease mde10 precursor (EC 3.4.24.-)| (Sporulation protein mde10) Length = 512 Score = 28.5 bits (62), Expect = 9.4 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 325 KYRKKLQRVLSAVSNIPQDI*REAYPSQPVLSIRFASWWEELLHGVA 465 KY V A+S P + RE++PS+P +S+ F S + HGV+ Sbjct: 152 KYESPGNNVFEAIS--PHE--RESFPSEPQVSVLFTSSVKRSPHGVS 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,347,546 Number of Sequences: 219361 Number of extensions: 1324253 Number of successful extensions: 3446 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3446 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)