| Clone Name | bastl12f04 |
|---|---|
| Clone Library Name | barley_pub |
>ARTE_ARATH (Q9FYL3) Protein ARTEMIS, chloroplast precursor (Arabidopsis| thaliana envelope membrane integrase) (Ath4) (ALBINO3-like protein 1) Length = 1013 Score = 35.4 bits (80), Expect = 0.084 Identities = 23/72 (31%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Frame = +3 Query: 261 AGFLSIDCGGSGNYTDARGLRWTSDAGIIXXXXXXXXXXXXXXXKQKEDTQYTTLRAFPA 440 A +SIDCG S ++ DA W D + K + TTLR FP Sbjct: 26 AADISIDCGSSSSHIDADNRTWVGDTDFVATGLTSKFVPF-----SKFPAELTTLRYFPT 80 Query: 441 DGAKHCYA-LPV 473 G +CY +PV Sbjct: 81 -GETNCYTNIPV 91
>MUC1_HUMAN (P15941) Mucin-1 precursor (MUC-1) (Polymorphic epithelial mucin)| (PEM) (PEMT) (Episialin) (Tumor-associated mucin) (Carcinoma-associated mucin) (Tumor-associated epithelial membrane antigen) (EMA) (H23AG) (Peanut-reactive urinary mucin) (PUM) Length = 1255 Score = 32.3 bits (72), Expect = 0.71 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +3 Query: 48 PSNHSDRATTGLLRHSMEMEQSSRPASTPPTQHRSSCSAYLRLAVLYAFFFL 203 PS+HSD TT L HS + + SS S+ P S+ S +L+ +FFFL Sbjct: 995 PSHHSDTPTT-LASHSTKTDASSTHHSSVPPLTSSNHSTSPQLSTGVSFFFL 1045
>SRTX_ATREN (P13208) Sarafotoxins precursor [Contains: Sarafotoxin A,| Ser-isoform (Sarafotoxin A) (S6A) (SRTX-A); Sarafotoxin C (S6C) (SRTX-C); Sarafotoxin B (S6B) (SRTX-B); Sarafotoxin E (S6E) (SRTX-E); Sarafotoxin A, Thr-isoform] Length = 543 Score = 30.4 bits (67), Expect = 2.7 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 88 GIPWRWSRAAGRLPLPQRNTDPL 156 GI WR ++ A R P PQRN +PL Sbjct: 287 GIIWRDTKQAARDPSPQRNVEPL 309
>FAS_RAT (P12785) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl-ca Length = 2505 Score = 29.3 bits (64), Expect = 6.0 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 186 KAQQDVNKQSKRIGVALGEWKPAGCSAPSPWNAGAVQ*SPC 64 +A +DV + ++ VA G+W P+G P+P N GA+ C Sbjct: 1273 QALKDVQTKLQQHDVAQGQWDPSG---PAPTNLGALDLVVC 1310
>SIRK_ARATH (O64483) Senescence-induced receptor-like serine/threonine-protein| kinase precursor (FLG22-induced receptor-like kinase 1) Length = 876 Score = 29.3 bits (64), Expect = 6.0 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +3 Query: 261 AGFLSIDCG--GSGNYTD-ARGLRWTSDAGIIXXXXXXXXXXXXXXXKQKEDTQYTTLRA 431 +GF+SIDCG +Y D G+++ SD+ + D +R+ Sbjct: 28 SGFISIDCGIPDDSSYNDETTGIKYVSDSAFV--DSGTTKRIAAQFQSSGFDRHLLNVRS 85 Query: 432 FPADGAKHCYALP 470 FP + CY +P Sbjct: 86 FP-QSKRSCYDVP 97
>T2R13_PONPY (Q645V1) Taste receptor type 2 member 13 (T2R13)| Length = 303 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 81 LLRHSMEMEQSSRPASTPPTQ-HRSSCSAYLRLAVLYAFFFLCSSLNAVSRAQMPTA 248 L +H +M+ + + P T+ H ++ + +LYA FFLC ++ +S TA Sbjct: 205 LQKHLQKMQLNYKGHREPRTKVHTNALKIVISFLLLYASFFLCILISWISELYQNTA 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,919,349 Number of Sequences: 219361 Number of extensions: 795823 Number of successful extensions: 2500 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2499 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)