| Clone Name | bastl12d09 |
|---|---|
| Clone Library Name | barley_pub |
>RT23_SCHPO (Q9UR07) Retrotransposable element Tf2 155 kDa protein type 3| Length = 1333 Score = 31.2 bits (69), Expect = 0.68 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 327 ISRYHSLVLTRSRPHPPQSHCLPVPKNETPWLLLLVNYL 211 + H+ + +SR H P P+P +E PW L ++++ Sbjct: 954 VQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFI 992
>RT22_SCHPO (Q9C0R2) Retrotransposable element Tf2 155 kDa protein type 2| Length = 1333 Score = 31.2 bits (69), Expect = 0.68 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 327 ISRYHSLVLTRSRPHPPQSHCLPVPKNETPWLLLLVNYL 211 + H+ + +SR H P P+P +E PW L ++++ Sbjct: 954 VQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFI 992
>RT21_SCHPO (Q05654) Retrotransposable element Tf2 155 kDa protein type 1| Length = 1333 Score = 31.2 bits (69), Expect = 0.68 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 327 ISRYHSLVLTRSRPHPPQSHCLPVPKNETPWLLLLVNYL 211 + H+ + +SR H P P+P +E PW L ++++ Sbjct: 954 VQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFI 992
>MCM7_XENLA (Q91876) DNA replication licensing factor MCM7 (CDC47 homolog)| (x.MCM7) Length = 720 Score = 30.8 bits (68), Expect = 0.89 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 141 NSPFSAGSEPHPLHGRDSSLKTVEGNLQAAAAMASRF 251 N+ S + +P +GR + KTVE N+Q AA+ SRF Sbjct: 478 NARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRF 514
>HEMA_CVMA5 (P31615) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 428 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -1 Query: 253 QKRDAMAAAACKLPSTVFKLESRPWSG*GSDPAENGE 143 ++ D M AAAC+LP F+ S +SG G+ A +G+ Sbjct: 309 RQSDNMTAAACQLPYCFFRNTSANYSG-GTHDAHHGD 344
>MILK1_HUMAN (Q8N3F8) Molecule interacting with Rab13 (MIRab13) (MICAL-like| protein 1) Length = 863 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 321 RYHSLVLTRSRPHPPQSHCLPVPKNETPWLLLL 223 R H L + + R P S P P+ + PW+ L+ Sbjct: 343 RLHELPVPKPRGTPKPSEGTPAPRKDPPWITLV 375
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 24.3 bits (51), Expect(2) = 7.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 82 HPRPLSAAERAAAPVYSAAPILRSP 156 HP P + A+ P+YS +P ++ P Sbjct: 177 HPPPPTYAQPPPTPIYSPSPQVQPP 201 Score = 21.9 bits (45), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 57 TPPVPQHPPS 86 TPP QHPPS Sbjct: 156 TPPRGQHPPS 165
>POLR_OYMV (P20127) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1776 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 10/32 (31%) Frame = -2 Query: 315 HSLVLTRSRPHPPQS----------HCLPVPK 250 HSL++TR PH P S +CLP+P+ Sbjct: 243 HSLLITRGLPHLPSSEKQQVSFHIPNCLPLPE 274
>YO092_YEAST (Q12010) Uncharacterized protein YOL092W| Length = 308 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 327 ISRYHSLVLTRSRPHPPQSHCLPVPKNETPWLLLLVNYL 211 IS Y + + ++P P + LPVP+ + W+ + YL Sbjct: 180 ISWYVTYCVNYTQPPPVEDPSLPVPELQINWMAQIFGYL 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,531,361 Number of Sequences: 219361 Number of extensions: 604276 Number of successful extensions: 1991 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1990 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)