| Clone Name | bastl12d08 |
|---|---|
| Clone Library Name | barley_pub |
>MAST1_HUMAN (Q9Y2H9) Microtubule-associated serine/threonine-protein kinase 1 (EC| 2.7.11.1) (Syntrophin-associated serine/threonine-protein kinase) Length = 1570 Score = 29.6 bits (65), Expect = 3.0 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 368 EQVRPGAKAACP-PLASSRQYVPAPIPEIRKLPEASR 261 E RPGAKA P PL + + + P P +PEA R Sbjct: 1439 EPARPGAKAVVPQPLGADSKGLQEPAPLAPSVPEAPR 1475
>C71A1_PERAE (P24465) Cytochrome P450 71A1 (EC 1.14.-.-) (CYPLXXIA1) (ARP-2)| Length = 471 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 171 KKPPNLPPQIRWSQPNLITPSRLHRRIQVSPRRLRKLTN 287 +K PNLPP S PNL LH+ + R LR L N Sbjct: 26 EKKPNLPP----SPPNLPIIGNLHQLGNLPHRSLRSLAN 60
>ABCB9_HUMAN (Q9NP78) ATP-binding cassette sub-family B member 9 precursor| (ATP-binding cassette transporter 9) (ABC transporter 9 protein) (TAP-like protein) (TAPL) (hABCB9) Length = 766 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = -2 Query: 383 VWWLREQVRPGAKAACPPLASSRQYVPA---PIPE 288 +WWL VRPG +A P A+ + P P PE Sbjct: 133 LWWLLSTVRPGTQALEPGAATEAEGFPGSGRPPPE 167
>NEST_HUMAN (P48681) Nestin| Length = 1618 Score = 28.1 bits (61), Expect = 8.8 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 14/61 (22%) Frame = -2 Query: 368 EQVRPGAKAACPPLASSRQYVPAPIPEI----RKLPEASR----------*HLDAAVEST 231 E+V A+AAC P + PAP PE+ R+L EA R H++ +++ T Sbjct: 147 ERVGLNAQAACAPRLPAPPRPPAPAPEVEELARRLGEAWRGAVRGYQERVAHMETSLDQT 206 Query: 230 R 228 R Sbjct: 207 R 207
>GP124_MOUSE (Q91ZV8) Probable G-protein coupled receptor 124 precursor (Tumor| endothelial marker 5) Length = 1329 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -2 Query: 371 REQVRPGAKAACPPLASSRQYVPAPIPEIRKLPEAS 264 R VR +A CPP + S +VPA R LP A+ Sbjct: 1063 RRDVRASWRACCPPASPSASHVPA-----RALPTAT 1093
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 28.1 bits (61), Expect = 8.8 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 130 DEFTTTISFRTTSPRNPPTYHR-RSAGASPI*SRRVDSTA 246 DE T ++ R S PP +H RSA SP+ +RR + A Sbjct: 214 DEATVVVAARRHSVSPPPLHHHSRSAPVSPVIARRGGAAA 253 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,779,211 Number of Sequences: 219361 Number of extensions: 763448 Number of successful extensions: 2858 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2855 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)