| Clone Name | bastl12c05 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 114 bits (284), Expect = 2e-25 Identities = 56/109 (51%), Positives = 74/109 (67%), Gaps = 4/109 (3%) Frame = +3 Query: 159 IRDITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGS----HHHEFGSNTPR 326 IRDI AAEA++KEGD F+LIT RWWQ WI+YV QD ++GS H GS+T + Sbjct: 24 IRDIAIAAEANSKEGDTFYLITQRWWQEWIEYVNQDQPCNTNDGSSLSEHCDSPGSSTLK 83 Query: 327 RPGAIDNTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWGKLHSW 473 +P IDN++L+ D + E E+ +TL EGRDY+LLPQ+VW +L SW Sbjct: 84 KPSRIDNSDLIYDSSLEDPSNTSEIIETLQEGRDYVLLPQEVWNQLRSW 132
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 55.8 bits (133), Expect = 5e-08 Identities = 36/103 (34%), Positives = 50/103 (48%) Frame = +3 Query: 165 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 344 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 345 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWGKLHSW 473 N+ LL D D Q L + L + DYILLP + W KL SW Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLPTEGWNKLVSW 103
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 55.8 bits (133), Expect = 5e-08 Identities = 36/103 (34%), Positives = 50/103 (48%) Frame = +3 Query: 165 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 344 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 345 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWGKLHSW 473 N+ LL D D Q L + L + DYILLP + W KL SW Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLPTEGWNKLVSW 103
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 52.0 bits (123), Expect = 8e-07 Identities = 30/93 (32%), Positives = 47/93 (50%) Frame = +3 Query: 195 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 374 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 375 EVSDMQIELHDTLAEGRDYILLPQQVWGKLHSW 473 + L + L + DY+L+P + W KL +W Sbjct: 81 QT------LKEHLIDELDYVLVPAEAWNKLLNW 107
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 52.0 bits (123), Expect = 8e-07 Identities = 30/93 (32%), Positives = 47/93 (50%) Frame = +3 Query: 195 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 374 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 375 EVSDMQIELHDTLAEGRDYILLPQQVWGKLHSW 473 + L + L + DY+L+P + W KL +W Sbjct: 81 QT------LKEHLIDELDYVLVPTEAWNKLLNW 107
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 45.8 bits (107), Expect = 6e-05 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 3/100 (3%) Frame = +3 Query: 183 EAHAKEGDIFFLITNRWWQSWIDYVI---QDSAGVPSNGSHHHEFGSNTPRRPGAIDNTN 353 E + G+ +FL+ W++ W YV QDS+ P G I+N Sbjct: 50 ERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFP-----------------GCINNAT 92 Query: 354 LLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWGKLHSW 473 L D ++ L + L EG DY+LLP W L SW Sbjct: 93 LFQD------EINWRLKEGLVEGEDYVLLPAAAWHYLVSW 126
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 39.7 bits (91), Expect = 0.004 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 5/56 (8%) Frame = +3 Query: 321 PRRPGAIDNTNLLDDMASEVSDMQIE---LHDT--LAEGRDYILLPQQVWGKLHSW 473 P++PGAIDN L+ + + + +E L T L GRDY ++P+ VW L+ W Sbjct: 518 PQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHW 573 Score = 31.2 bits (69), Expect = 1.4 Identities = 22/93 (23%), Positives = 35/93 (37%), Gaps = 12/93 (12%) Frame = +3 Query: 201 GDIFFLITNRWWQSWIDYVIQD------------SAGVPSNGSHHHEFGSNTPRRPGAID 344 G +F+I+ +WWQ W +YV D + G S G+ H R ++ Sbjct: 393 GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLS 452 Query: 345 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLP 443 N ++ S+ E +T G Y P Sbjct: 453 YVNTTEEKFSDNISTASEASETAGSGFLYSATP 485
>Y1052_HAEIN (P45008) Putative HTH-type transcriptional regulator HI1052| Length = 298 Score = 31.6 bits (70), Expect = 1.1 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +3 Query: 189 HAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHH-----HEFGSNTP 323 H KEGD+FFL N+ + Y A +P+ SH H+ G TP Sbjct: 59 HLKEGDVFFLPQNQ--PHSMHYSANKRADIPTKKSHQGLFELHQIGRGTP 106
>APJ_MACMU (O97666) Apelin receptor (G-protein coupled receptor APJ)| (Angiotensin receptor-like 1) Length = 380 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +1 Query: 337 LLTIQICWMTWHLKSPTCRLSYMIPW-------LKAVIIYCSLSKSGESCI 468 ++T +CWM +HL L ++ W L V YC+ SC+ Sbjct: 254 VVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNVFPYCTCISYVNSCL 304
>APJ_RAT (Q9JHG3) Apelin receptor (G-protein coupled receptor APJ)| (Angiotensin receptor-like 1) (B78) (GPCR34) Length = 377 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +1 Query: 337 LLTIQICWMTWHLKSPTCRLSYMIPW-------LKAVIIYCSLSKSGESCI 468 ++T +CWM +HL L ++ W L V YC+ SC+ Sbjct: 252 VVTFALCWMPYHLVKTLYMLGNLLHWPCDFDSFLMNVFPYCTCISYVNSCL 302
>APJ_MOUSE (Q9WV08) Apelin receptor (G-protein coupled receptor APJ)| (Angiotensin receptor-like 1) (MSR) Length = 377 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +1 Query: 337 LLTIQICWMTWHLKSPTCRLSYMIPW-------LKAVIIYCSLSKSGESCI 468 ++T +CWM +HL L ++ W L V YC+ SC+ Sbjct: 252 VVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNSCL 302 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,748,569 Number of Sequences: 219361 Number of extensions: 952239 Number of successful extensions: 3117 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3085 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)