| Clone Name | bastl11b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLCAP_SOYBN (P11827) Beta-conglycinin, alpha' chain precursor | 29 | 3.6 | 2 | LNT_RICPR (Q9ZDG3) Apolipoprotein N-acyltransferase (EC 2.3.1.-)... | 28 | 4.7 | 3 | ATG9_ASHGO (Q75A48) Autophagy-related protein 9 | 28 | 6.2 | 4 | GWT1_CRYNV (Q873N0) GPI-anchored wall transfer protein 1 (EC 2.3... | 28 | 8.1 | 5 | CT111_MOUSE (Q9D722) Protein C20orf111 homolog | 28 | 8.1 |
|---|
>GLCAP_SOYBN (P11827) Beta-conglycinin, alpha' chain precursor| Length = 639 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 8 HPKLKQDESFC*RSFPFPR-*DPHSTKEHGNSYSNECRC*QC*HGG 142 H + ++DE R FPFPR PH +EH +E + HGG Sbjct: 89 HGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGG 134
>LNT_RICPR (Q9ZDG3) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 496 Score = 28.5 bits (62), Expect = 4.7 Identities = 21/63 (33%), Positives = 34/63 (53%) Frame = -2 Query: 250 LLEPFLEITAAYW*GIVFSIPDSETSALTLLTTDPSTSMLALLAPAFIAIGVAMFFGTVR 71 L++P L IT Y G+ F + TSA + T T + LLA + + + V + +G VR Sbjct: 149 LIQP-LSITGIY--GLSFIVIYISTSAYPVFTKK-FTQLKILLASSMLILTVMVIYGAVR 204 Query: 70 ISS 62 +S+ Sbjct: 205 VST 207
>ATG9_ASHGO (Q75A48) Autophagy-related protein 9| Length = 897 Score = 28.1 bits (61), Expect = 6.2 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = +1 Query: 49 IPIPQMRSSQYQRT--WXXXXXXXXXXXXXAWRLMDQLLTMSMQRFLNQGLKKRFLTSML 222 +PIP R+S +T W A L L + + FL++ LKKRF+ + Sbjct: 419 LPIPLYRTSTLTKTLEWNIHLCIIGFAFNEAGFLKQSFLNPAQREFLSEELKKRFILAGF 478 Query: 223 L 225 L Sbjct: 479 L 479
>GWT1_CRYNV (Q873N0) GPI-anchored wall transfer protein 1 (EC 2.3.-.-)| (Inositol acyltransferase GWT1) Length = 598 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -2 Query: 172 ALTLLTTDPSTSMLALLAPAFIAIGVAMFFGTVRISSGEW 53 A LLT + SM + APA++++GV M + T+ IS W Sbjct: 551 AANLLTGLVNVSMKTMYAPAWLSMGVLMLY-TLTISCVGW 589
>CT111_MOUSE (Q9D722) Protein C20orf111 homolog| Length = 291 Score = 27.7 bits (60), Expect = 8.1 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +3 Query: 12 PSSSRMKVSANDHSHSPDEILTVPKNMATPIAMNAGANSASMEVD 146 PSSS++K + PD I + ++TP NAG NS S++V+ Sbjct: 101 PSSSQLK--HRSQTEPPDGISG--RGISTPKEFNAGENSTSLDVN 141 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,477,595 Number of Sequences: 219361 Number of extensions: 536304 Number of successful extensions: 1242 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)