| Clone Name | bastl11a05 |
|---|---|
| Clone Library Name | barley_pub |
>Y4QF_RHISN (P55627) Probable peptidase y4qF (EC 3.4.21.-)| Length = 754 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 Query: 174 SLSPPLPEAQPRIRVV 221 SL PPLP A+PRIRV+ Sbjct: 36 SLRPPLPRAEPRIRVL 51
>BRCA2_FELCA (Q864S8) Breast cancer type 2 susceptibility protein homolog (Fanconi| anemia group D1 protein homolog) Length = 3372 Score = 28.9 bits (63), Expect = 3.0 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -2 Query: 301 SVVDLASPFHRLYPRSQKGPRPGSAHLTTRILGCASGSGGERERESPR 158 S ++ SP P+++ P PGSA +T++ S GERE + P+ Sbjct: 3166 SEMNYQSPLSLCKPKAKSVPTPGSAQMTSK-----SCYKGERELDDPK 3208
>VRP1_YEAST (P37370) Verprolin| Length = 817 Score = 28.9 bits (63), Expect = 3.0 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -1 Query: 272 PSLSSVPKRT*AWICTPHDPNPXXXXXXXXXXXXRV-APPRLGHPLSTTTRLGPSK 108 P+++S PK+ + P P P PP L PL TT + P+K Sbjct: 336 PNVTSAPKKATSAPAPPPPPLPAAMSSASTNSVKATPVPPTLAPPLPNTTSVPPNK 391
>FBPC_AGRT5 (Q8U6M1) Ferric cations import ATP-binding protein fbpC (EC| 3.6.3.30) Length = 353 Score = 28.5 bits (62), Expect = 4.0 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = -2 Query: 307 DTSVVDLASPFHRLYPRSQKGPRPGSAHLTTR----ILGCASGSG 185 D S+V + + HR+ R GPR GSA L R +G A GSG Sbjct: 255 DESLVRVGTMEHRVRSR---GPRSGSAKLAVRPGAITIGAAGGSG 296
>BTNL2_RAT (Q6MG97) Butyrophilin-like protein 2 precursor| Length = 454 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 76 SNPPLAVEG*GFEGPNLVVVERGW 147 S+P + VEG G EG LV RGW Sbjct: 146 SSPNIHVEGPGEEGVQLVCTSRGW 169
>SC10A_MOUSE (Q6QIY3) Sodium channel protein type 10 alpha subunit (Sodium| channel protein type X alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.8) (Peripheral nerve sodium channel 3) (Sensory neuron sodium channel) Length = 1958 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/19 (68%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 133 LPRD*APQNPNP-PRRGED 80 LPR PQ+PNP PRRGE+ Sbjct: 548 LPRSPLPQSPNPGPRRGEE 566
>E13B_SOYBN (P52395) Glucan endo-1,3-beta-glucosidase (EC 3.2.1.39)| ((1->3)-beta-glucan endohydrolase) ((1->3)-beta-glucanase) (Beta-1,3-endoglucanase) (Fragment) Length = 255 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 91 AVEG*GFEGPNLVVVERGWPRRGGATLSL 177 A+E G +VV E GWP GGA S+ Sbjct: 168 ALENVGASNLQIVVSESGWPSEGGAGASI 196
>E13A_SOYBN (Q03773) Glucan endo-1,3-beta-glucosidase precursor (EC 3.2.1.39)| ((1->3)-beta-glucan endohydrolase) ((1->3)-beta-glucanase) (Beta-1,3-endoglucanase) Length = 347 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 91 AVEG*GFEGPNLVVVERGWPRRGGATLSL 177 A+E G N+VV E GWP GG SL Sbjct: 255 ALEKAGGGSLNIVVSESGWPSSGGTATSL 283
>104K_THEPA (P15711) 104 kDa microneme-rhoptry antigen precursor (p104)| Length = 924 Score = 28.1 bits (61), Expect = 5.2 Identities = 23/79 (29%), Positives = 32/79 (40%), Gaps = 21/79 (26%) Frame = -2 Query: 262 PRSQKGPRPGSAHLTTRILGCASGSGGE------------RERESPRLASAT-------- 143 P S K P P H ++I + G R+ +SPR AS T Sbjct: 547 PGSGKKPGPAREHKPSKIPTLSKKPSGPKDPKHPRDPKEPRKSKSPRTASPTRRPSPKLP 606 Query: 142 -LFLLPRD*APQNPNPPRR 89 L LP+ +P++P PP R Sbjct: 607 QLSKLPKSTSPRSPPPPTR 625
>MYST3_MOUSE (Q8BZ21) Histone acetyltransferase MYST3 (EC 2.3.1.48) (EC 2.3.1.-)| (MYST protein 3) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3) (Monocytic leukemia zinc finger protein) (Monocytic leukemia zinc finger homolog) Length = 2003 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -2 Query: 181 ERERESPRLASATLF---LLPRD*APQNPNPPRRG 86 +++ E LAS++ LPRD P N PPRRG Sbjct: 834 DKKPEVKELASSSRLSKQALPRDSLPANSQPPRRG 868
>AUTS2_HUMAN (Q8WXX7) Autism susceptibility gene 2 protein| Length = 1259 Score = 27.3 bits (59), Expect = 8.8 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -2 Query: 247 GPRPGSAHLTTRILGCASGSGGERERESPRLASATLFLLPRD*APQNPNPPRR 89 G G TR L AS SG ++E P AP P PPRR Sbjct: 33 GAAGGGGAGRTRALSLASSSGSDKEDNGK----------PPSSAPSRPRPPRR 75
>SALL2_HUMAN (Q9Y467) Sal-like protein 2 (Zinc finger protein SALL2) (HSal2)| Length = 1007 Score = 27.3 bits (59), Expect = 8.8 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -2 Query: 232 SAHLTTRILGCASGSGGERERESPRLASATLFLLPRD*APQNPNPP 95 S H G A+G GG SP+L + LP + P P PP Sbjct: 122 SGHFLVAATGTAAGGGGGLILASPKLGATP---LPPESTPAPPPPP 164
>IF2_GLUOX (Q5FQM3) Translation initiation factor IF-2| Length = 917 Score = 27.3 bits (59), Expect = 8.8 Identities = 23/88 (26%), Positives = 35/88 (39%), Gaps = 14/88 (15%) Frame = -2 Query: 310 HDTSVVDLASPFHRLYPRSQKG---PR-----------PGSAHLTTRILGCASGSGGERE 173 H T V LA+P RL P +++ PR P + T + A+ G + Sbjct: 196 HSTGGVQLAAPVQRLRPLAERAIMPPRPVQPSRPAAAAPARNNETLHLRSGAAAGGDDER 255 Query: 172 RESPRLASATLFLLPRD*APQNPNPPRR 89 R +PR + P P+ P+ P R Sbjct: 256 RPAPRRSGPGAPPAP----PRRPSAPSR 279 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,098,716 Number of Sequences: 219361 Number of extensions: 713604 Number of successful extensions: 1918 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1918 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)