| Clone Name | bastl10e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MSH2_MAIZE (Q9XGC9) DNA mismatch repair protein MSH2 (MUS1) | 45 | 7e-05 |
|---|
>MSH2_MAIZE (Q9XGC9) DNA mismatch repair protein MSH2 (MUS1)| Length = 942 Score = 44.7 bits (104), Expect = 7e-05 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = +3 Query: 45 EDFLPEGGKLPELS-*SRQAQG-SSPS*EVPKDPRAIRLFD 161 +DF PEGGKLPE +RQAQG S ++P+DPRA+RLFD Sbjct: 4 DDFTPEGGKLPEFKLDARQAQGFISFFKKLPQDPRAVRLFD 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,726,181 Number of Sequences: 219361 Number of extensions: 471915 Number of successful extensions: 1587 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1586 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)