| Clone Name | bastl09h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GHR_BOVIN (O46600) Growth hormone receptor precursor (GH recepto... | 29 | 3.3 | 2 | VNS1_AHSV9 (Q85967) Nonstructural protein NS1 | 28 | 5.7 | 3 | Y281_BUCAI (P57368) Hypothetical transport protein BU281 | 28 | 7.4 | 4 | RADA_THEVO (Q97BJ9) DNA repair and recombination protein radA | 27 | 9.7 | 5 | GHR_BOSIN (P79108) Growth hormone receptor precursor (GH recepto... | 27 | 9.7 |
|---|
>GHR_BOVIN (O46600) Growth hormone receptor precursor (GH receptor)| (Somatotropin receptor) [Contains: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)] Length = 634 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 209 PSRMENLPNVSACIAEKNQENGTSDDAGEPEEVADVLVYRED 334 P R++ ++S C+ +KNQ N S+DA + V++ E+ Sbjct: 410 PQRLKGEADIS-CLDQKNQNNSPSNDAAPASQQPSVILVEEN 450
>VNS1_AHSV9 (Q85967) Nonstructural protein NS1| Length = 548 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 198 LYSFLQEWRTYQMSLHVLLRRTRKMGHL 281 LY +WRT+ + LH L RT ++GHL Sbjct: 296 LYDGSLDWRTWTVPLH--LMRTARLGHL 321
>Y281_BUCAI (P57368) Hypothetical transport protein BU281| Length = 307 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 267 SWFFSAIHAETFGRFSILEGSYTGRFRG 184 SWF + H TF SIL Y G F G Sbjct: 198 SWFIESPHINTFSNRSILAIFYLGDFSG 225
>RADA_THEVO (Q97BJ9) DNA repair and recombination protein radA| Length = 323 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +2 Query: 218 MENLPNVSACIAEKNQENGTSD----DAGEPEEVADV 316 +E+LP V AEK +ENG D P++++DV Sbjct: 14 LEDLPGVGEATAEKLRENGYDDIMAIAVASPKDLSDV 50
>GHR_BOSIN (P79108) Growth hormone receptor precursor (GH receptor)| (Somatotropin receptor) [Contains: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)] Length = 634 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 209 PSRMENLPNVSACIAEKNQENGTSDDAGEPEEVADVLVYRED 334 P R++ ++S C+ +KNQ N S+DA + V+ E+ Sbjct: 410 PQRLKGEADIS-CLDQKNQNNSPSNDAAPANQQPSVIHVEEN 450 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,013,394 Number of Sequences: 219361 Number of extensions: 326319 Number of successful extensions: 1125 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)