| Clone Name | bastl09f11 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 79.0 bits (193), Expect = 3e-15 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = +2 Query: 182 NVSYDHRAVRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEGGADVIET 331 +VSYDH+A+ + GQR++L+S +HYPR+TPEMWP +I K KEGG DVI+T Sbjct: 23 SVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQT 72
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 77.8 bits (190), Expect = 6e-15 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = +2 Query: 182 NVSYDHRAVRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEGGADVIET 331 +VSYDH+A+ I GQ+R+L+S +HYPR+TPEMWP +I K K+GG DVI+T Sbjct: 25 SVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQT 74
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 77.0 bits (188), Expect = 1e-14 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = +2 Query: 182 NVSYDHRAVRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEGGADVIET 331 +V+YDH++V I GQRR+L+S +HYPR+TPEMWP +I K K+GG DVI+T Sbjct: 26 SVTYDHKSVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQT 75
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 70.9 bits (172), Expect = 8e-13 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +2 Query: 182 NVSYDHRAVRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEGGADVIET 331 NV YD+RA++I QRR+L+S +HYPR+TPEMWP II K K+ DVI+T Sbjct: 30 NVWYDYRAIKINDQRRILLSGSIHYPRSTPEMWPDIIEKAKDSQLDVIQT 79
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = +2 Query: 185 VSYDHRAVRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEGGADVIET 331 VS+D RA+ I GQRR+L+S +HYPR+T +MWP +I+K K+GG D IET Sbjct: 27 VSHDERAITIDGQRRILLSGSIHYPRSTSDMWPDLISKAKDGGLDTIET 75
>BGAL_CANFA (Q9TRY9) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 668 Score = 33.5 bits (75), Expect = 0.14 Identities = 17/61 (27%), Positives = 23/61 (37%) Frame = +2 Query: 149 RGTDGPYFEPFNVSYDHRAVRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEGGADVIE 328 RG F + Y H GQ +S +HY R W + K K G + I+ Sbjct: 23 RGLRNASQRTFTIDYSHNRFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQ 82 Query: 329 T 331 T Sbjct: 83 T 83
>BGAL_FELCA (O19015) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 669 Score = 32.0 bits (71), Expect = 0.40 Identities = 17/61 (27%), Positives = 23/61 (37%) Frame = +2 Query: 149 RGTDGPYFEPFNVSYDHRAVRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEGGADVIE 328 RG F + Y H GQ +S +HY R W + K K G + I+ Sbjct: 23 RGLRNASQRTFKIDYGHNRFLKDGQPFRYISGSIHYFRVPRFYWKDRLLKMKMAGLNAIQ 82 Query: 329 T 331 T Sbjct: 83 T 83
>SYV_CORDI (Q6NFV0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 919 Score = 29.6 bits (65), Expect = 2.0 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = +2 Query: 89 VAGYFTASALAAGELSQVVGRGTDGPYFEPFNVSYDHRAVRIGGQRRMLVSAG 247 VA LA +++G+GTDG PFN + H VR R+M S G Sbjct: 516 VARMMMFGTLAGETTPEILGQGTDGRPQIPFNDLFLHGLVRDEQGRKMSKSLG 568
>SYV_COREF (Q8FN65) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 903 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = +2 Query: 89 VAGYFTASALAAGELSQVVGRGTDGPYFEPFNVSYDHRAVRIGGQRRMLVSAG 247 VA AA E +++G GTDG PF + H VR R+M S G Sbjct: 506 VARMMMFGTFAAKETPELLGEGTDGRPQVPFTDLFLHGLVRDEHGRKMSKSLG 558
>TPN50_TREPA (P38369) Outer membrane protein tpn50 precursor (Antigen tpp57)| Length = 417 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 146 GRGTDGPYFEPFNVSYDHRA-VRIGGQRRMLVSAGVHYPRATPEMWPSIIAKCKEG 310 G G P+ PF VSY +R V+ G +R ++A +P+ + KEG Sbjct: 161 GFGIQTPFIVPFTVSYTYRGEVQRGSRRYHHITAAYSMSYESPKRTHGVQRNAKEG 216
>TF2B_RAT (P62916) Transcription initiation factor IIB (General transcription| factor TFIIB) (RNA polymerase II alpha initiation factor) Length = 316 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 116 LAAGELSQVVGRGTDGPYFEPF-NVSYDHRAVRIGGQRRML 235 L+ G+LS ++G+GT F+ F N Y +R R M+ Sbjct: 75 LSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMM 115
>TF2B_PONPY (Q5R886) Transcription initiation factor IIB (General transcription| factor TFIIB) Length = 316 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 116 LAAGELSQVVGRGTDGPYFEPF-NVSYDHRAVRIGGQRRML 235 L+ G+LS ++G+GT F+ F N Y +R R M+ Sbjct: 75 LSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMM 115
>TF2B_MOUSE (P62915) Transcription initiation factor IIB (General transcription| factor TFIIB) (RNA polymerase II alpha initiation factor) Length = 316 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 116 LAAGELSQVVGRGTDGPYFEPF-NVSYDHRAVRIGGQRRML 235 L+ G+LS ++G+GT F+ F N Y +R R M+ Sbjct: 75 LSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMM 115
>TF2B_HUMAN (Q00403) Transcription initiation factor IIB (General transcription| factor TFIIB) (S300-II) Length = 316 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 116 LAAGELSQVVGRGTDGPYFEPF-NVSYDHRAVRIGGQRRML 235 L+ G+LS ++G+GT F+ F N Y +R R M+ Sbjct: 75 LSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMM 115
>TF2B_XENLA (P29054) Transcription initiation factor IIB (General transcription| factor TFIIB) Length = 316 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 116 LAAGELSQVVGRGTDGPYFEPF-NVSYDHRAVRIGGQRRML 235 L+ G+L+ ++G+GT F+ F N Y +R R M+ Sbjct: 75 LSGGDLTTMIGKGTGSASFDEFGNSKYQNRRTMSSSDRAMM 115
>PRMA_XANCP (Q8PD33) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 306 Score = 28.1 bits (61), Expect = 5.7 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 95 GYFTASALAAGELSQVVGRGTDGPYFEPFNVSYDHRAVRIGGQRR 229 G S + G+ +V R T P+FE + YD VRI G RR Sbjct: 263 GRIALSGIMQGQEQDLVQRYT--PWFEHLHCEYDAEWVRIDGVRR 305
>VCF2_LAMBD (P03714) Tail attachment protein (Minor capsid protein FII)| Length = 117 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +2 Query: 89 VAGYF-TASALAAGELSQVVGRGTDGPYFEPFNVSYDHRAVRIGG 220 + GY T++ + +GE S V RG + +P N+SY + VR+ G Sbjct: 19 IRGYMGTSATITSGEQSGAVIRGV---FDDPENISYAGQGVRVEG 60
>CATA_RHIME (P95631) Catalase A (EC 1.11.1.6)| Length = 494 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 217 ADAHRAMIVAHVERLEVGAIRPPPHH 140 ADAHR + H E + V R P HH Sbjct: 338 ADAHRYRLGTHYEHIPVNQPRCPVHH 363
>TRP_NEUCR (P13228) Tryptophan synthase (EC 4.2.1.20)| Length = 708 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 236 VSAGVHYPRATPEMWPSIIAKCKEGGADVIE 328 V+AG +P TP+ I+ ++GGADVIE Sbjct: 23 VTAGFPHPEQTPD----ILLAMEKGGADVIE 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,229,171 Number of Sequences: 219361 Number of extensions: 546244 Number of successful extensions: 1734 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1734 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)