| Clone Name | bastl08g05 |
|---|---|
| Clone Library Name | barley_pub |
>DRS1_DEBHA (Q6BTL5) ATP-dependent RNA helicase DRS1 (EC 3.6.1.-)| Length = 771 Score = 33.9 bits (76), Expect = 0.22 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 102 DADREGENQSPSLSEENQVDLDLDAGNKGK 13 D+D EGEN+ P L EE++VD +L K K Sbjct: 27 DSDSEGENEIPDLEEESEVDQELKEEEKPK 56
>RSP1_CAEEL (Q23121) Probable splicing factor, arginine/serine-rich 1| (RNA-binding protein srp-5) (CeSRp75) Length = 312 Score = 30.8 bits (68), Expect = 1.9 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = -3 Query: 328 SESPMAMAARTD*SENLVRARIAHADLD*DPPRRKESISSSISPYILDQSPSLPEENQTP 149 S SP + R S++ R+R AD ++S S S SP +D+SPS P +++P Sbjct: 238 SRSPPKRSRRESKSKSRSRSRSRSAD-------NRKSRSPSRSPKKVDRSPSPPRGSRSP 290 Query: 148 SISG 137 S G Sbjct: 291 SEKG 294
>YQS1_CAEEL (Q09309) Hypothetical WD-repeat protein F21H12.1| Length = 454 Score = 29.6 bits (65), Expect = 4.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 101 SHKCLDPVCIDWSRDGRRLI 160 S CL C+ WSRDGR+L+ Sbjct: 64 SAHCLPVSCLSWSRDGRKLL 83
>DDFL1_MOUSE (Q5U464) Development and differentiation enhancing factor-like 1| Length = 904 Score = 29.3 bits (64), Expect = 5.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -3 Query: 238 PPRRKESISSSISPYILDQSPSLPEE--NQTPSISGP 134 P S++SS+ P L Q+PS PEE ++ SIS P Sbjct: 796 PASSSSSLTSSVEPGGLSQAPSSPEEGLQESASISRP 832
>MPP3_HUMAN (Q13368) MAGUK p55 subfamily member 3 (MPP3 protein) (Discs large| homolog 3) Length = 585 Score = 28.5 bits (62), Expect = 9.2 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -3 Query: 250 LD*DPPRRKESISSSISPYILDQSPSLPEENQTPSIS 140 +D +P K+ +S PYI+ P++ E+ +TP +S Sbjct: 481 VDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMS 517
>CC020_HUMAN (Q8ND61) Protein C3orf20| Length = 904 Score = 28.5 bits (62), Expect = 9.2 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = -1 Query: 246 IKTHQEGKNLFHHQSVHIYWINHLPSLKKIKRLPSLDQSMHTGSRHL 106 ++THQE N F QS+H+ L L ++K + ++ +SM G+ L Sbjct: 127 VRTHQETLNRFQQQSIHL-----LTELLRLK-MKAMVESMSVGANPL 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,553,793 Number of Sequences: 219361 Number of extensions: 1505061 Number of successful extensions: 3505 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3502 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)