| Clone Name | bastl08e04 |
|---|---|
| Clone Library Name | barley_pub |
>POT2_ARATH (O22881) Potassium transporter 2 (AtPOT2) (AtKUP2) (AtKT2)| Length = 794 Score = 40.0 bits (92), Expect = 0.003 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = +1 Query: 340 MDLELAHGAGAPRKRGESWGAVLLLAYQSLGVV 438 MDL L G+ + ESW +VLLLAYQSLGVV Sbjct: 1 MDLNLGKCCGSRSSKKESWRSVLLLAYQSLGVV 33
>HAK8_ORYSA (Q8VXB5) Putative potassium transporter 8 (OsHAK8)| Length = 793 Score = 37.7 bits (86), Expect = 0.013 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +1 Query: 340 MDLELAHGAGAPRKRGESWGAVLLLAYQSLGVV 438 MDLE G +P++ +SW LLLAYQSLGVV Sbjct: 1 MDLEFGRGMRSPQR--DSWKTTLLLAYQSLGVV 31
>HAK9_ORYSA (Q7XIV8) Probable potassium transporter 9 (OsHAK9)| Length = 788 Score = 36.6 bits (83), Expect = 0.028 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +1 Query: 340 MDLELAHGAGAPRKRGESWGAVLLLAYQSLGVV 438 MD E G APRKR E W LLLAYQSLGVV Sbjct: 1 MDPEFGRGM-APRKR-EPWRTTLLLAYQSLGVV 31
>HAK13_ORYSA (Q652J4) Probable potassium transporter 13 (OsHAK13)| Length = 778 Score = 32.3 bits (72), Expect = 0.54 Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Frame = +1 Query: 361 GAGAPRKRGESWG---AVLLLAYQSLGVV 438 G GAP + SWG LLLAYQS GVV Sbjct: 10 GGGAPPRGRNSWGWQKGTLLLAYQSFGVV 38
>POT8_ARATH (Q9M7J9) Potassium transporter 8 (AtPOT8) (AtHAK8)| Length = 781 Score = 32.0 bits (71), Expect = 0.70 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = +1 Query: 340 MDLELAHGAGAPRKRGESWGAVLLLAYQSLGVV 438 MDLE +K ESW VL LAYQSLGVV Sbjct: 1 MDLERLSPRNPVKK--ESWWTVLTLAYQSLGVV 31
>POT6_ARATH (Q8W4I4) Potassium transporter 6 (AtPOT6) (AtHAK6)| Length = 782 Score = 31.2 bits (69), Expect = 1.2 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = +1 Query: 346 LELAHGAGAPRKRGESWGAVLLLAYQSLGVV 438 +E+ G+ K+ ESW VL LAYQSLGVV Sbjct: 1 MEIESGSYQNAKK-ESWRTVLTLAYQSLGVV 30
>GRISA_PODAN (Q92258) GRISEA protein (MAC1 homolog)| Length = 597 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 124 PPRLPRSPLVARSRRSK--AGWRGRVCVGGGDKSPRCDLP 237 PP P +P++ S SK G G C GGG K+P+ P Sbjct: 250 PPPPPSNPVLEPSAMSKPKGGSGGGGCCGGGKKAPQIQAP 289
>RB6I2_HUMAN (Q8IUD2) RAB6-interacting protein 2 (ERC protein 1)| Length = 1116 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 121 RPPRLPRSPLVARSRRSKAGWRGRVCVGGG 210 R PRLPRSP + R + G VGGG Sbjct: 20 RSPRLPRSPRLGHRRTNSTGGSSGSSVGGG 49
>RB6I2_MOUSE (Q99MI1) RAB6-interacting protein 2 (ERC protein 1) (ERC1)| (CAZ-associated structural protein 2) (CAST2) Length = 1120 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 121 RPPRLPRSPLVARSRRSKAGWRGRVCVGGG 210 R PRLPRSP + R + G VGGG Sbjct: 20 RSPRLPRSPRLGHRRTNSTGGSSGNSVGGG 49
>RB6I2_RAT (Q811U3) RAB6-interacting protein 2 (ERC protein 1) (ERC1)| (CAZ-associated structural protein 2) (CAST2) Length = 948 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 121 RPPRLPRSPLVARSRRSKAGWRGRVCVGGG 210 R PRLPRSP + R + G VGGG Sbjct: 20 RSPRLPRSPRLGHRRTNSTGGSSGNSVGGG 49
>ZO3_MOUSE (Q9QXY1) Tight junction protein ZO-3 (Zonula occludens 3 protein)| (Zona occludens 3 protein) (Tight junction protein 3) Length = 905 Score = 28.9 bits (63), Expect = 5.9 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 8/51 (15%) Frame = +1 Query: 157 RSRRSKAGWRGRV------CVGGGDKSPRCDLPGGSR--PSVRLLLAVIRS 285 RSRRS+AG RGRV GGG ++ DL G + P +L+ ++S Sbjct: 137 RSRRSRAGRRGRVGSHGRRSSGGGSEANGLDLVSGYKRLPKQDVLMRPLKS 187
>ICP0_BHV1K (P29836) Trans-acting transcriptional protein ICP0 (P135 protein)| (IER 2.9/ER2.6) Length = 676 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Frame = -3 Query: 309 RGAHGSARAPNHRKKK---TDGRTTPARQIAPR 220 RGA G+ARA +++ T GR TPA Q APR Sbjct: 335 RGASGAARARRPAERQYVSTRGRQTPAVQPAPR 367
>ICP0_BHV1J (P29128) Trans-acting transcriptional protein ICP0 (P135 protein)| (IER 2.9/ER2.6) Length = 676 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Frame = -3 Query: 309 RGAHGSARAPNHRKKK---TDGRTTPARQIAPR 220 RGA G+ARA +++ T GR TPA Q APR Sbjct: 335 RGASGAARARRPAERQYVSTRGRQTPAVQPAPR 367 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,942,896 Number of Sequences: 219361 Number of extensions: 832757 Number of successful extensions: 2859 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2859 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)