| Clone Name | bastl07d06 |
|---|---|
| Clone Library Name | barley_pub |
>BIOH_VIBVY (Q7MPY0) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 32.3 bits (72), Expect = 0.67 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 288 LAVEDLEYAGHAAHLAAVELRHVVSQGVEHPPRR 187 L V DL GH+AHL A L + Q +EH P++ Sbjct: 42 LHVVDLPGYGHSAHLHAASLEEIAQQLLEHAPKQ 75
>BIOH_VIBVU (Q8DDU4) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 32.3 bits (72), Expect = 0.67 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 288 LAVEDLEYAGHAAHLAAVELRHVVSQGVEHPPRR 187 L V DL GH+AHL A L + Q +EH P++ Sbjct: 42 LHVVDLPGYGHSAHLHAASLEEIAQQLLEHAPKQ 75
>RSMB_ERIEU (Q9TU67) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 228 GVRPPPDGLHGRHIPDLRPP 287 G+RPPP G+ G P LRPP Sbjct: 219 GMRPPPPGMRGPPPPGLRPP 238
>RSMN_RAT (P63164) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) Length = 240 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 228 GVRPPPDGLHGRHIPDLRPP 287 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMN_MOUSE (P63163) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 228 GVRPPPDGLHGRHIPDLRPP 287 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMN_HUMAN (P63162) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 228 GVRPPPDGLHGRHIPDLRPP 287 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMB_MONDO (Q9TU66) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 228 GVRPPPDGLHGRHIPDLRPP 287 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>RSMB_HUMAN (P14678) Small nuclear ribonucleoprotein-associated proteins B and| B' (snRNP-B) (Sm protein B/B') (Sm-B/Sm-B') (SmB/SmB') Length = 240 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 228 GVRPPPDGLHGRHIPDLRPP 287 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>RSMB_CHICK (Q9PV94) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 228 GVRPPPDGLHGRHIPDLRPP 287 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>SC24C_ARATH (Q9M291) Protein transport protein Sec24-like CEF| Length = 1097 Score = 28.9 bits (63), Expect = 7.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 237 PPPDGLHGRHIPDLRPPADAHGAS 308 PPP G+HG H+ + PP+ G + Sbjct: 197 PPPSGMHGGHLSNGPPPSGMPGGT 220
>V1BR_HUMAN (P47901) Vasopressin V1b receptor (V1bR) (AVPR V1b) (Vasopressin V3| receptor) (AVPR V3) (Antidiuretic hormone receptor 1b) Length = 424 Score = 28.5 bits (62), Expect = 9.7 Identities = 20/65 (30%), Positives = 25/65 (38%), Gaps = 9/65 (13%) Frame = -2 Query: 267 YAGHAAHLAAVELRHVVSQGVEHPPRR---------GHHPTLPNRSNAGPDENRCFTFTA 115 Y G +HL LRH+ G P R H TL RS+ + + T Sbjct: 338 YMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTL 397 Query: 114 HGRPR 100 GRPR Sbjct: 398 SGRPR 402
>NPT3_HUMAN (O00624) Sodium-dependent phosphate transport protein 3| (Sodium/phosphate cotransporter 3) (Na(+)/PI cotransporter 3) (Solute carrier family 18 member 2) Length = 436 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +1 Query: 139 LVWAGV*SVWERWVMPAARRVLNALADDMPEFDRRQMGCMAGI 267 + W G ++W +W P R L +A F + C+ G+ Sbjct: 160 MAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGL 202
>IR12_HCMVA (P16810) Hypothetical protein IRL12 (TRL12)| Length = 416 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 203 STPWLTTCRSSTAARWAAWPAYSRSSTASGC 295 STPWLT C ++T + Y+R+++++ C Sbjct: 161 STPWLTNCSATT------YTTYNRTNSSNAC 185
>BRCA1_MACMU (Q6J6I9) Breast cancer type 1 susceptibility protein homolog| Length = 1863 Score = 28.5 bits (62), Expect = 9.7 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 159 SNAGPDENRCFTFTAHGRPRCXXXAPGRS*EKEEKVLKAETKRKKKRQSEK 7 SN G E C TF+AH RS +K+ + +E ++K++ Q +K Sbjct: 872 SNPGNPEEECATFSAH----------SRSLKKQSPKVTSECEQKEENQGKK 912 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,754,269 Number of Sequences: 219361 Number of extensions: 900433 Number of successful extensions: 2756 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2745 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)