| Clone Name | bastl07c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOP14_HUMAN (P78316) Probable nucleolar complex protein 14 | 33 | 0.16 | 2 | NOP14_MOUSE (Q8R3N1) Probable nucleolar complex protein 14 | 32 | 0.27 | 3 | NOP14_SCHPO (O43051) Probable nucleolar complex protein 14 | 28 | 6.8 | 4 | APLP_MANSE (Q25490) Apolipophorins precursor [Contains: Apolipop... | 27 | 8.8 |
|---|
>NOP14_HUMAN (P78316) Probable nucleolar complex protein 14| Length = 857 Score = 33.1 bits (74), Expect = 0.16 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +1 Query: 295 SNPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHKR 408 SNPFE +R+KF +LG+K + + SR+ A+ KR Sbjct: 29 SNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKR 66
>NOP14_MOUSE (Q8R3N1) Probable nucleolar complex protein 14| Length = 860 Score = 32.3 bits (72), Expect = 0.27 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +1 Query: 298 NPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHKR 408 NPFE +R+KF +LG+K + + SR+ A+ KR Sbjct: 30 NPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKR 66
>NOP14_SCHPO (O43051) Probable nucleolar complex protein 14| Length = 827 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 298 NPFEAIWSRRKFDVLGKKRKGEERRTSRSR 387 N F+ +++RKFDV G++ KG E + SR Sbjct: 52 NLFDRQFTKRKFDVGGRRVKGTEGKPGVSR 81
>APLP_MANSE (Q25490) Apolipophorins precursor [Contains: Apolipophorin-2| (Apolipophorin II) (apoLp-2); Apolipophorin-1 (Apolipophorin I) (apoLp-1)] Length = 3305 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -3 Query: 400 GQRRSGSGRCASPR-PCASCRARRTCGATRW 311 G RRS S C PR P +C AR G W Sbjct: 2967 GYRRSRSRGCCPPRCPTPACAARTATGPGSW 2997 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,006,149 Number of Sequences: 219361 Number of extensions: 308881 Number of successful extensions: 1315 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1315 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)