| Clone Name | bastl07c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 54 | 2e-07 | 2 | CX017_HUMAN (Q9NX05) Protein CXorf17 (Tumor antigen BJ-HCC-21) | 31 | 1.2 | 3 | CX017_MOUSE (Q8C3F2) Protein CXorf17 homolog | 31 | 1.6 | 4 | NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 pr... | 28 | 7.9 |
|---|
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 53.5 bits (127), Expect = 2e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 347 ADDENPEDFIDPETPSGQKKSLAPXMAKQYSPS 445 A +ENPEDF+DPETP G++K L+ MAKQYSP+ Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQMAKQYSPA 143
>CX017_HUMAN (Q9NX05) Protein CXorf17 (Tumor antigen BJ-HCC-21)| Length = 1096 Score = 31.2 bits (69), Expect = 1.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 63 SAGARPRRRDHPYHPISHHGEAR 131 S GA P R HP H HHG+A+ Sbjct: 76 SGGAGPTRHHHPAHHFHHHGQAQ 98
>CX017_MOUSE (Q8C3F2) Protein CXorf17 homolog| Length = 1091 Score = 30.8 bits (68), Expect = 1.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 63 SAGARPRRRDHPYHPISHHGEA 128 S GA P R HP H HHG+A Sbjct: 76 SGGAGPSRHHHPAHHFHHHGQA 97
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch| 4) [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 28.5 bits (62), Expect = 7.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 179 RQTASPLTPHISGACATGFS 120 R SPLTPH S C +GF+ Sbjct: 88 RSPTSPLTPHFSCTCPSGFT 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,870,975 Number of Sequences: 219361 Number of extensions: 382552 Number of successful extensions: 1239 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1239 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)