| Clone Name | bastl07c05 |
|---|---|
| Clone Library Name | barley_pub |
>BCAR1_MOUSE (Q61140) Breast cancer anti-estrogen resistance protein 1| (CRK-associated substrate) (p130cas) Length = 874 Score = 32.7 bits (73), Expect = 0.45 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 333 PGQMQHFQQPGPHMPHSGH--VPPASQAVPMLYQAVRPMS 446 PG QP P +P H VPPASQ PML A +P S Sbjct: 76 PGPPATPPQPQPSLPQGVHAPVPPASQYSPMLPTAYQPQS 115
>CACP_COLLI (P52826) Carnitine O-acetyltransferase precursor (EC 2.3.1.7)| (Carnitine acetylase) (CAT) (Carnitine acetyltransferase) (CrAT) Length = 627 Score = 32.3 bits (72), Expect = 0.58 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 291 RPVGQAMPGVNMGMPGQMQHFQQPGPHMPHSGHVPPASQAVPMLYQAVRPMSS 449 RP G P +PG+ Q Q+ PH+P VPP Q + A++P+ S Sbjct: 12 RPYGLLKPAALGKIPGRFQLHQEALPHLP----VPPLQQTLDRYLLALQPIIS 60
>BRD4_MOUSE (Q9ESU6) Bromodomain-containing protein 4 (Mitotic| chromosome-associated protein) (MCAP) Length = 1400 Score = 31.2 bits (69), Expect = 1.3 Identities = 18/32 (56%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 354 QQPGPHMPHSGHVPPASQA-VPMLYQAVRPMS 446 Q PGP M PPAS A VPML Q +RP S Sbjct: 1105 QPPGPVMGQGQGCPPASPAAVPMLSQELRPPS 1136
>BCAR1_RAT (Q63767) Breast cancer anti-estrogen resistance protein 1| (CRK-associated substrate) (p130cas) Length = 968 Score = 31.2 bits (69), Expect = 1.3 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 333 PGQMQHFQQPGPHMPHSGH--VPPASQAVPMLYQAVRP 440 PG QP P +P H VPPASQ PML A +P Sbjct: 170 PGPPATPPQPQPSLPQGVHTPVPPASQYSPMLPTAYQP 207
>RTN2_HUMAN (O75298) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 545 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 12 PSLDSTLESRPSTDRDPTPSRRTAASNIPP 101 PSL +LES PS + P P RR PP Sbjct: 103 PSLGDSLESIPSLSQSPEPGRRGDPDTAPP 132
>PP1RA_XENLA (Q6GLQ4) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 Length = 819 Score = 30.0 bits (66), Expect = 2.9 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 294 PVGQAMPG-VNMGMPGQMQHFQQPGP--HMPHSGHVPP 398 P GQ G VN+G P Q QP P H P H PP Sbjct: 622 PAGQGSQGPVNIGFPPPSQKNHQPPPPHHQPPPPHYPP 659
>YC66L_SYNY3 (Q55823) Ycf66-like protein| Length = 337 Score = 29.6 bits (65), Expect = 3.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 27 TLESRPSTDRDPTPSRRTAASNIPP 101 T RP DP PSRR SN PP Sbjct: 225 TRRPRPEAGNDPAPSRRPRPSNNPP 249
>PS1C1_HUMAN (Q9UIG5) Psoriasis susceptibility 1 candidate gene 1 protein| (SEEK1 protein) Length = 152 Score = 29.3 bits (64), Expect = 4.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 25 RLSSLDPQPTETRPPHAGPQRV 90 +L + DP ETRPPH P R+ Sbjct: 25 QLLNTDPSSKETRPPHVNPDRL 46
>SFPQ_MOUSE (Q8VIJ6) Splicing factor, proline- and glutamine-rich| (Polypyrimidine tract-binding protein-associated splicing factor) (PTB-associated splicing factor) (PSF) (DNA-binding p52/p100 complex, 100 kDa subunit) Length = 699 Score = 28.5 bits (62), Expect = 8.4 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +3 Query: 303 QAMPGVNMGMPGQMQHFQQPGPHM-PHSGHVPPASQAVPMLYQ---AVRPMSSAP 455 Q P P Q QQP PH PH PP ++ P++ Q + +SSAP Sbjct: 67 QQQPPPQQPPPQQPPPHQQPPPHQPPHQQPPPPPQESKPVVPQGPGSAPGVSSAP 121
>RDS_FELCA (P35906) Peripherin (Retinal degeneration slow protein)| Length = 346 Score = 28.5 bits (62), Expect = 8.4 Identities = 16/67 (23%), Positives = 36/67 (53%) Frame = +1 Query: 223 PCSGHQVRHNSLLSSCNQRHNSIDLLVRPCQELTWACQGRCNIFSNLGHICLILVMFRLH 402 PC +Q+ +NS S + + ++L VR C+ + G ++ +++G + L++ +F + Sbjct: 221 PCIQYQLTNNSAHYSYDHQTEELNLWVRGCRAALLSYYG--SLMNSMGAVTLLVWLFEVS 278 Query: 403 HKLFLCY 423 + L Y Sbjct: 279 ITIGLRY 285
>DCE2_RAT (Q05683) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 199 HKIWDNQCPCSGHQVRHNSLLSSCNQRHNS 288 HK+ CS VR L+ SCNQ H S Sbjct: 395 HKMMGVPLQCSALLVREEGLMQSCNQMHAS 424
>DCE2_PIG (P48321) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 199 HKIWDNQCPCSGHQVRHNSLLSSCNQRHNS 288 HK+ CS VR L+ SCNQ H S Sbjct: 395 HKMMGVPLQCSALLVREEGLMQSCNQMHAS 424
>DCE2_MOUSE (P48320) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 199 HKIWDNQCPCSGHQVRHNSLLSSCNQRHNS 288 HK+ CS VR L+ SCNQ H S Sbjct: 395 HKMMGVPLQCSALLVREEGLMQSCNQMHAS 424
>DCE2_CANFA (Q4PRC2) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 199 HKIWDNQCPCSGHQVRHNSLLSSCNQRHNS 288 HK+ CS VR L+ SCNQ H S Sbjct: 395 HKMMGVPLQCSALLVREEGLMQSCNQMHAS 424 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,390,153 Number of Sequences: 219361 Number of extensions: 1071673 Number of successful extensions: 3895 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3884 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)