| Clone Name | bastl06g10 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 81.6 bits (200), Expect = 8e-16 Identities = 43/91 (47%), Positives = 58/91 (63%), Gaps = 4/91 (4%) Frame = +3 Query: 189 IRDITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGS----HHHEFGSNTPR 356 IRDI AAEA++KEGD F+LIT RWWQ WI+YV QD ++GS H GS+T + Sbjct: 24 IRDIAIAAEANSKEGDTFYLITQRWWQEWIEYVNQDQPCNTNDGSSLSEHCDSPGSSTLK 83 Query: 357 RPGAIDNTNLLDDMASEVSDMQIELHDTLAE 449 +P IDN++L+ D + E E+ +TL E Sbjct: 84 KPSRIDNSDLIYDSSLEDPSNTSEIIETLQE 114
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 37.4 bits (85), Expect = 0.017 Identities = 21/67 (31%), Positives = 32/67 (47%) Frame = +3 Query: 195 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 374 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 375 NTNLLDD 395 N+ LL D Sbjct: 67 NSGLLKD 73
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 37.4 bits (85), Expect = 0.017 Identities = 21/67 (31%), Positives = 32/67 (47%) Frame = +3 Query: 195 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 374 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 375 NTNLLDD 395 N+ LL D Sbjct: 67 NSGLLKD 73
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 34.7 bits (78), Expect = 0.11 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +3 Query: 225 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 404 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 405 E 407 + Sbjct: 81 Q 81
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 34.7 bits (78), Expect = 0.11 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +3 Query: 225 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 404 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 405 E 407 + Sbjct: 81 Q 81
>Y1052_HAEIN (P45008) Putative HTH-type transcriptional regulator HI1052| Length = 298 Score = 31.6 bits (70), Expect = 0.95 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +3 Query: 219 HAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHH-----HEFGSNTP 353 H KEGD+FFL N+ + Y A +P+ SH H+ G TP Sbjct: 59 HLKEGDVFFLPQNQ--PHSMHYSANKRADIPTKKSHQGLFELHQIGRGTP 106
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 30.8 bits (68), Expect = 1.6 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +3 Query: 231 GDIFFLITNRWWQSWIDYVIQDSAGV---PSNGSHHHEFGSNTPRRP 362 G +F+I+ +WWQ W +YV D+ V PS+ + ++ T P Sbjct: 393 GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHP 439
>PO121_RAT (P52591) Nuclear envelope pore membrane protein POM 121 (Pore| membrane protein of 121 kDa) (P145) Length = 1199 Score = 30.4 bits (67), Expect = 2.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 9 GKTKASPEAKPFVYPVAPSKLKEKPSPTLTLAQSSSPAS 125 G ASP KP ++P P + P PT + A +++PAS Sbjct: 692 GPACASPMFKP-IFPATPKSESDNPLPTSSSAATTTPAS 729
>H1_YEAST (P53551) Histone H1| Length = 258 Score = 29.6 bits (65), Expect = 3.6 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 30 EAKPFVYPVAPSKLKEKPSPTLTLAQSSSPAS 125 +AK +AP K+ +K SPT+T ++SSP+S Sbjct: 146 KAKAASTKLAPKKVVKKKSPTVTAKKASSPSS 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,237,490 Number of Sequences: 219361 Number of extensions: 843565 Number of successful extensions: 3158 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3124 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)