| Clone Name | bastl06d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPY_HORVU (O82422) Probable UDP-N-acetylglucosamine--peptide N-a... | 53 | 2e-07 | 2 | SPY_ORYSA (Q6YZI0) Probable UDP-N-acetylglucosamine--peptide N-a... | 35 | 0.033 | 3 | YICF_ECOLI (P25772) Hypothetical DNA ligase-like protein yicF | 30 | 1.4 | 4 | SPY_PETHY (O82039) Probable UDP-N-acetylglucosamine--peptide N-a... | 28 | 6.8 |
|---|
>SPY_HORVU (O82422) Probable UDP-N-acetylglucosamine--peptide| N-acetylglucosaminyltransferase SPINDLY (EC 2.4.1.-) (HvSPY) Length = 944 Score = 53.1 bits (126), Expect = 2e-07 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = +2 Query: 263 MESLQGKESXXXXXXXXXXXXXXXXXXKQQLPEGTDALRYANILRSR 403 MESLQGKES KQQLPEGTDALRYANILRSR Sbjct: 1 MESLQGKESNGAVPVCNGGGGAAAPPAKQQLPEGTDALRYANILRSR 47
>SPY_ORYSA (Q6YZI0) Probable UDP-N-acetylglucosamine--peptide| N-acetylglucosaminyltransferase SPINDLY (EC 2.4.1.-) Length = 927 Score = 35.4 bits (80), Expect = 0.033 Identities = 23/49 (46%), Positives = 27/49 (55%) Frame = +2 Query: 257 PGMESLQGKESXXXXXXXXXXXXXXXXXXKQQLPEGTDALRYANILRSR 403 PGM+S +G+ES KQQL +G D LRYANILRSR Sbjct: 4 PGMDSSEGRESNGVVPERNGGAVPA----KQQL-DGKDTLRYANILRSR 47
>YICF_ECOLI (P25772) Hypothetical DNA ligase-like protein yicF| Length = 560 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 252 TNERERERVSFSLPSYWRAAPGTGAGR 172 ++ER ++ FS +W+ PGTG+GR Sbjct: 504 SDERSWSQLLFSTEQFWQQLPGTGSGR 530
>SPY_PETHY (O82039) Probable UDP-N-acetylglucosamine--peptide| N-acetylglucosaminyltransferase SPINDLY (EC 2.4.1.-) (PhSPY) Length = 932 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +2 Query: 359 EGTDALRYANILRSR 403 EG DA+ YANILRSR Sbjct: 47 EGKDAITYANILRSR 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,976,529 Number of Sequences: 219361 Number of extensions: 490389 Number of successful extensions: 1100 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1086 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)