| Clone Name | bastl06b06 |
|---|---|
| Clone Library Name | barley_pub |
>CAND2_HUMAN (O75155) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) Length = 1119 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = +1 Query: 358 ITGILEKMTGKDKDYRYMATSDLLSE 435 I+ +LEKMT DKD+R+MATSDL+SE Sbjct: 8 ISSLLEKMTSSDKDFRFMATSDLMSE 33
>CAND1_RAT (P97536) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) (TBP-interacting protein TIP120A) (TBP-interacting protein of 120 kDa A) Length = 1230 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +1 Query: 337 VAMANTDITGILEKMTGKDKDYRYMATSDLLSE 435 +A A+ I+ +LEKMT DKD+R+MAT+DL++E Sbjct: 1 MASASYHISNLLEKMTSSDKDFRFMATNDLMTE 33
>CAND1_MOUSE (Q6ZQ38) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) Length = 1230 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +1 Query: 337 VAMANTDITGILEKMTGKDKDYRYMATSDLLSE 435 +A A+ I+ +LEKMT DKD+R+MAT+DL++E Sbjct: 1 MASASYHISNLLEKMTSSDKDFRFMATNDLMTE 33
>CAND1_HUMAN (Q86VP6) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) (TBP-interacting protein TIP120A) (TBP-interacting protein of 120 kDa A) Length = 1230 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +1 Query: 337 VAMANTDITGILEKMTGKDKDYRYMATSDLLSE 435 +A A+ I+ +LEKMT DKD+R+MAT+DL++E Sbjct: 1 MASASYHISNLLEKMTSSDKDFRFMATNDLMTE 33
>CAND2_MOUSE (Q6ZQ73) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) (TBP-interacting protein TIP120B) (TBP-interacting protein of 120 kDa B) Length = 1235 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = +1 Query: 358 ITGILEKMTGKDKDYRYMATSDLLSE 435 I+ +LEKMT DKD+R+MATSDL+SE Sbjct: 8 ISSLLEKMTSSDKDFRFMATSDLMSE 33
>CAND1_PONPY (Q5R6L5) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) Length = 1230 Score = 39.7 bits (91), Expect = 0.003 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = +1 Query: 337 VAMANTDITGILEKMTGKDKDYRYMATSDLLSE 435 +A A+ I+ +LEKMT KD+R+MAT+DL++E Sbjct: 1 MASASYHISNLLEKMTSSGKDFRFMATNDLMTE 33
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 30.8 bits (68), Expect = 1.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 141 KESQCCTTPCCAARGTTPPQ 82 K +QCC TPCC + PP+ Sbjct: 6 KTNQCCPTPCCPPKPCCPPK 25
>CUBN_MOUSE (Q9JLB4) Cubilin precursor (Intrinsic factor-cobalamin receptor)| Length = 3623 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 5 PPARCSAPLRSLFPASAIGRRRAGSFCGGVVPR 103 P CS +F +IG R G FCG +P+ Sbjct: 3087 PSNLCSHDYLEVFDGPSIGNRSIGKFCGSTLPQ 3119
>PLS3_RAT (Q6QBQ4) Phospholipid scramblase 3 (PL scramblase 3)| (Ca(2+)-dependent phospholipid scramblase 3) Length = 296 Score = 29.3 bits (64), Expect = 4.3 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 153 GCGGKESQCCTTPCCAARGTTPPQNEPARRLPIADAGNRE 34 G +ES CC CC AR R+ +AD G+RE Sbjct: 118 GQAAEESNCCARLCCGARRPL--------RIRLADPGDRE 149
>TRI17_HUMAN (Q9Y577) Tripartite motif protein 17 (Testis RING finger protein)| (RING finger protein 16) Length = 477 Score = 29.3 bits (64), Expect = 4.3 Identities = 21/54 (38%), Positives = 28/54 (51%) Frame = +2 Query: 236 LRQVSDRIEAKQASLLLLEDTVEYLCEEDLNTGLSRWRIQT*PASWRR*QGKIK 397 L +V EA Q L LE+ +EYL E+ TG + R + A W QGK+K Sbjct: 129 LHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEW---QGKVK 179
>PLS3_MOUSE (Q9JIZ9) Phospholipid scramblase 3 (PL scramblase 3)| (Ca(2+)-dependent phospholipid scramblase 3) Length = 296 Score = 28.9 bits (63), Expect = 5.7 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 153 GCGGKESQCCTTPCCAARGTTPPQNEPARRLPIADAGNRE 34 G +ES CC CC AR R+ +AD G+RE Sbjct: 118 GQAAEESNCCARLCCGARRPF--------RIRLADPGDRE 149
>PLS3_HUMAN (Q9NRY6) Phospholipid scramblase 3 (PL scramblase 3)| (Ca(2+)-dependent phospholipid scramblase 3) Length = 295 Score = 28.9 bits (63), Expect = 5.7 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 153 GCGGKESQCCTTPCCAARGTTPPQNEPARRLPIADAGNRE 34 G +ES CC CC AR R+ +AD G+RE Sbjct: 117 GQAAEESNCCARLCCGARRPL--------RVRLADPGDRE 148
>NOS_ORYSA (Q6YPG5) Putative nitric-oxide synthase (EC 1.14.13.39)| Length = 547 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 214 PTPLQSEPPTSFRSNRSQASFPPPPRG 294 P P + P+SF R+ ++ PPPP G Sbjct: 21 PKPQLAPNPSSFSPTRAASTAPPPPEG 47
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 28.5 bits (62), Expect = 7.4 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 153 GCGGKESQCCTTPCC 109 GCGG S CC CC Sbjct: 34 GCGGSGSSCCVPVCC 48
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = -2 Query: 129 CCTTPCCAARGTTP----PQNEPARRLPI 55 CCTT CC + P PARR+P+ Sbjct: 183 CCTTSCCRPSSSVSLLCRPVCRPARRVPV 211 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,292,285 Number of Sequences: 219361 Number of extensions: 877712 Number of successful extensions: 3148 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3139 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)